KEGG   Pseudoalteromonas sp. SM9913: PSM_B0510Help
Entry
PSM_B0510         CDS       T01374                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psm  Pseudoalteromonas sp. SM9913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:psm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSM_B0510
Enzymes [BR:psm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PSM_B0510
Exosome [BR:psm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSM_B0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:557890..560112
Genome map
AA seq 740 aa AA seqDB search
MGSTKNRVSTQLVDYDAQVNALTAGRFKDPFSFLGAHNTQSGTEIRVYLPAALRVELLID
GQVISALRYKHSDLFIAELSSMPSSVYQCQVSYENSDVRFYDEYSFSSTLDEQAMYLFNE
GSLEHAYTHLGAQFTTQQGVDGVRFCVWAPNAASVSVIGEFNFWQANRHFMRFHPASGVW
ELFIPGLSADMCYKFAITTLSGEVLDKADPFAFKMQQAPGTASILQYKPAPILLSEQAII
NRQKRNHIDAAISIYEVHLGSWQRAEHNRYLSYTELADKLVGYVIEMGFTHLQLMPISEY
PFDGSWGYQPVGLFAPTSRFGDYNSFKYLVEQCHKANIGILLDWVPGHFPSDPHGLHCFD
GTHLYEHADMRQGFHPDWNTYIYNYDRPEVKSFLISNAMYWLSQFGIDGLRVDAVASMLY
LDYSRKEGQWVANCYGGRENLGAIECLKQVNLRSYKNNPGIMMVAEESTAWPGVTQSVEH
NGLGFGYKWNMGWMNDSLDYMQQDPLFRKYHHHKMTFSMVYAFSENYILPLSHDEVVHGK
GSLLNKMPGDDWQQFANLRAYYAFMWAHPGKKLLFMGAEIAQRKEWDHDHSLDWHLLEHQ
SHQGIQHTVKRLNQVYQAHPSLYELDSCATGFSWIDNNNSQQSMFSFIRYAKNADHFMVI
VANFTPTAYQHYTLGVPAKGTYKVVLNTDEVCFFGSGYRVTEDKNQLIHSVVQPSHGFDH
SITVNIGGLTTLYLEKVNDE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtactaaaaatagggtatcaacgcaattagttgattatgacgcacaggtaaac
gcattaactgcagggcgatttaaagacccgtttagttttttaggcgcgcacaacacccaa
agtggcactgaaatacgcgtgtatttgccagcggcattacgcgtcgaactgttaattgat
ggtcaagttattagcgcgttacgctataaacacagtgatttatttatcgctgagttatca
agcatgcctagcagtgtttaccaatgccaggttagttatgaaaatagcgatgttagattt
tatgatgaatacagcttcagcagtacattggatgaacaggctatgtacttgtttaacgaa
ggtagccttgagcatgcttatactcacctaggtgcgcaatttactacacaacaaggggta
gatggtgttcgtttttgtgtgtgggcgcctaatgccgccagtgtatcggttattggtgag
tttaatttttggcaagcgaatcgccattttatgcgatttcatccggcaagtggggtatgg
gaattatttatcccgggtttaagtgcagacatgtgctacaaatttgctattactacgctc
agtggcgaagttttagataaagccgatccttttgcatttaaaatgcagcaagcaccgggc
actgccagtatattacagtacaaaccagcgcctattttgctaagtgaacaagcgattata
aatcgccaaaagcgtaatcatattgatgccgctattagtatttatgaagtgcacttaggc
tcttggcaacgcgctgagcataaccgttacttaagctacaccgagcttgcagataagctt
gtaggctacgtgattgaaatggggttcacgcatttacaacttatgccgatcagtgaatac
ccgtttgatggctcttggggttatcagccagtagggctgtttgcacctacgagccgcttt
ggtgattacaacagctttaaatacttagttgagcaatgtcataaagctaacataggcata
ttacttgattgggttcctgggcactttccaagcgacccacatggcttacattgctttgat
ggcacccatttatacgaacacgctgatatgcgccaagggtttcatcctgattggaacacc
tatatttataattatgaccgccctgaagtaaaaagctttttaatttctaatgcgatgtat
tggcttagccaatttggcatagacggactgcgtgtagatgcggtggcgtcaatgctttac
cttgattacagtcgtaaagaaggacagtgggtagctaattgttatggcggtcgagaaaac
ttaggggcaatagagtgcctaaaacaagtgaacttacgcagttataaaaataaccccggc
attatgatggttgccgaggagtcaacggcttggcctggggtcacgcaaagtgttgaacac
aatggcttaggttttggttataaatggaatatgggctggatgaatgacagcttagattat
atgcagcaagatccgttatttagaaaatatcaccatcataaaatgacattttctatggtg
tatgcatttagtgaaaattatattttaccgctcagtcatgatgaagtggtgcatggcaag
ggatcactactaaacaaaatgcccggtgacgattggcagcagtttgcaaacttacgtgct
tattatgcgtttatgtgggcacatccaggcaaaaaattactgtttatgggcgccgaaata
gcacagcgcaaagagtgggatcatgaccattcactagactggcacttgcttgagcatcaa
agccatcaagggattcagcatacggttaaacgtcttaatcaagtgtatcaagcgcatcca
tctttatatgagcttgatagctgtgcaacgggcttttcatggatagataataataacagc
cagcagagtatgtttagctttattcgttatgctaaaaatgctgaccactttatggttatt
gtcgctaactttacaccaacggcttatcaacactacaccttaggtgtgccagcgaagggc
acatataaagtggtattaaataccgatgaagtttgcttttttggctcaggttatcgtgtc
acagaggataaaaaccagcttatccattcagtcgttcagccaagtcatgggtttgatcac
agtattacagttaatattggtggcttaaccacactttacttagaaaaggtgaatgatgag
taa

DBGET integrated database retrieval system