KEGG   Pedobacter saltans: Pedsa_0496Help
Entry
Pedsa_0496        CDS       T01430                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
psn  Pedobacter saltans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pedsa_0496
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pedsa_0496
   00600 Sphingolipid metabolism
    Pedsa_0496
Enzymes [BR:psn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Pedsa_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618627..620780
Genome map
AA seq 717 aa AA seqDB search
MKKIFIAFLTFTATLAVHAQNKEIVLETKNSALVYVIRDNQKVYQAYLGQKLNQSADYAK
VGGPQKEAYIGAGMEDFFEPAIRVVHADGNPSLDLRVSEQRINKEGNITTASITLKDPKY
PTQVVLHFQSFFNEDIIKTWTEIRNGEKGTITLYNYASSMLHFNAPNYWLSQFDGDYMTE
MRMKESKLTTGIKTLDSKLGSRAHMYRTPVFYLSLGNLSTEKTGELIAGTLGWSGNFQSS
FEIDQANNLRVINGINPYASDYKLAAGQTFVTPEFIFTHTLNGKGQATRNLHDWARNYGV
LDGTKPRMTLLNNWEATHMDFNQDILVELFDGAKKLGVDLFLLDDGWFGNKYPRDADKTA
LGDWQTDKKKLPSGIGYLVKQAETKELKFGIWLEPEMISPKSELYERHPDWILKLPNREE
SLSRHQLVLDLVNPKVQDFVFKVVDDLMKENPNIAFIKWDCNRPMTSTYSPYLKTNQSNT
YVDYTKSLYKVLERLRAKYPHLPIMLCAGGGGRTDYGALKYFTEFWPSDNTDGFERIFIQ
WGYLNFFPALTVSSHITSMGKQPIKFRTDVAMMGKMGYDIRVNKMTNEEIEFSNQAVKTY
KKLSDVIWFGDLYRLISPYEEPRAVLMYADKNKNRAVVFNYILNYRRKEYLGKVKLEGLD
ANKKYKIEEVNLMPGTKSALAENGKVYSGDFLMKVGLNLAPGKVQAVSSSVIELTAQ
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatatttattgcgtttctaacttttactgcaactctggcggttcatgcacaa
aacaaagagattgttttagaaaccaagaattcggcattagtttatgtcataagagataat
caaaaagtatatcaggcttatttaggacaaaagcttaatcaaagcgcggactatgctaag
gtaggaggtccacagaaagaggcctatattggtgcaggaatggaagatttcttcgagcct
gcaatcagagtggttcatgcagacggaaacccatctttggatcttagagtatcagaacag
agaattaataaagaaggtaatataacaacggcaagtattacgctgaaagatcctaaatat
cctacacaggttgtattacattttcaaagtttctttaatgaagatataattaaaacctgg
acagagatcagaaacggagaaaagggaacaatcaccttatataattatgcttcttctatg
ttgcatttcaatgcgccaaattattggttaagccaatttgatggtgattatatgactgag
atgcgaatgaaagaatctaaactaactacaggaattaaaacactggatagtaagttgggg
tccagagcacatatgtatcgcacaccagttttctatctgtctttaggaaatttatctaca
gaaaaaacaggagagcttattgcaggtactttagggtggtcgggcaattttcaatcttct
tttgagattgaccaagctaataatcttagggtaattaacggcattaacccctatgcttct
gactataaactggctgcgggacaaacttttgttacacctgaattcatttttacacatacg
ttgaatggcaaggggcaggctaccagaaatttgcatgactgggcaagaaattacggtgta
ttggatgggacaaaaccacgaatgaccttattaaacaactgggaagctactcatatggat
tttaatcaggatattctggtagaactgtttgatggagccaagaaattgggtgtagattta
tttttgttggatgacggttggtttggaaacaaatatccaagagatgcagacaaaaccgct
ttaggcgattggcaaactgataagaagaagttaccaagcggaattggttatctggtaaaa
caagctgaaactaaagaactaaagtttgggatctggttagaaccggaaatgattagccct
aaaagcgagctttatgaaaggcatccggattggatattaaaattacctaatagggaagaa
agtttgtcccgacatcaattggtgttggatttggtgaatcctaaagtgcaggattttgtg
tttaaagttgtagatgatttgatgaaagaaaatccgaacattgcttttataaagtgggat
tgcaacaggccaatgaccagtacttactctccttatctaaaaactaatcaatctaatact
tatgtagattataccaaaagtttgtataaagtattggaaagattgagagcaaaatacccg
catttgccaattatgctttgtgctggcggaggcggaagaacggattatggagcgttaaaa
tattttactgaattttggccaagtgataatacagacggtttcgaacgtatttttatccaa
tggggatatttgaatttctttccggctttaactgtgtccagtcatatcacatctatgggg
aaacaacctataaagtttagaacagatgttgccatgatgggtaaaatgggctatgatatc
cgcgtaaataaaatgaccaatgaggagatagaatttagcaatcaggcggttaaaacctat
aaaaagttgagtgatgtgatttggtttggagatttataccgtttgatttcgccatatgaa
gaaccaagagcagtattaatgtatgccgataaaaataaaaacagagctgtcgtctttaat
tatattctgaattaccgaagaaaagaatacttgggtaaggtgaagttagaggggttagat
gcaaataaaaaatataaaattgaagaagtaaaccttatgcctggaacaaaatctgcatta
gcagaaaatggaaaagtttacagcggagatttcctgatgaaagttggtttaaatctggct
ccgggaaaagtacaggcagtgtcaagctctgtaatcgaattaacagcacaataa

DBGET integrated database retrieval system