KEGG   Pseudopedobacter saltans: Pedsa_0536Help
Entry
Pedsa_0536        CDS       T01430                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00260  Glycine, serine and threonine metabolism
psn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01130  Biosynthesis of antibiotics
psn01230  Biosynthesis of amino acids
Module
psn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pedsa_0536
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pedsa_0536
Enzymes [BR:psn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pedsa_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ADY51116
UniProt: F0S6P0
Position
complement(665462..666652)
Genome map
AA seq 396 aa AA seqDB search
MGDSTNIKVGPLDSMLEHNGAYGPYGGAYIPPVLEGQLKKLADFFDEEVKTDDFKNEFIR
ILKQYVGRPSPLYYAKNLSDYVGSKIYLKREDLNHTGSHKINNCIGQILLAKKMGAKEII
AETGAGQHGVATATASAILGIPCKVFMGEIDVERQALNVRRMRLLGAEVIPTNLGSRTLK
DAVDAALGYYIQNPESFYLLGSHVGPHPYPRMVGYFQSVIGNEARQQILAEEGKLPKHIF
AAVGGGSNAIGLFSGFLADDEVEIHGAEGGGEGIYPNTAATLSFGKPAVFQGTMSYCLVD
DEGNPIPSKSIAAGLDYPGISPQHAHMKDSGRAKYYPVTDAEAVEAYKLLSRLEGITPAI
ESSHAVALAMKVLKNKGELAIVNVSGRGDKDVEREM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggagacagtacgaatatcaaagtgggaccattggatagtatgttggaacacaatgga
gcttatggtccctacggtggggcatatatacctccggtacttgaaggacaactaaaaaaa
ctggcagactttttcgacgaagaagtaaaaaccgatgatttcaaaaacgaatttatccgc
attttaaaacagtatgtaggccggccttccccattatactatgcaaaaaatctgagcgat
tatgttggttctaaaatttacttaaaacgtgaagatttaaaccataccggttctcacaag
atcaataattgtatcggacaaatcttgctggctaaaaaaatgggggctaaagaaattatt
gccgaaaccggtgccgggcaacatggtgtagccacagctactgcctcagctattttaggc
atcccttgtaaagttttcatgggcgaaatagatgtggaaagacaagctttaaacgtacgt
cgtatgcgtttgctgggtgccgaagttatacctacaaaccttggcagcagaactttaaaa
gacgctgttgatgctgctttaggatattatatacaaaatccagagtctttttatttactg
ggttcacatgtaggccctcacccatatccacgcatggttggttatttccagtctgtaatt
ggtaacgaagccagacagcaaattttagcagaagaaggtaaattacctaagcatattttt
gctgctgttggcggaggttccaatgccataggattattttctggttttttagcagatgac
gaagtggaaatccatggagcagaaggtggtggcgaaggtatttaccctaatacagcggca
acactttcctttggaaaacctgcggtatttcagggaacaatgtcttattgtctggtagac
gatgaaggaaacccgattccatcgaaatccatcgctgctggtttggattatcctggaatt
tctccgcaacatgcacacatgaaagacagtggaagagcaaaatactatccggtaacagat
gcagaggctgttgaggcctacaaattattgtcgagattagaaggtattactcctgctatc
gaatcttcacatgcggttgctttagctatgaaagtcctaaaaaacaaaggcgaactggct
atagtaaacgtttccggaagaggcgacaaagatgtagaaagagaaatgtaa

DBGET integrated database retrieval system