KEGG   Pedobacter saltans: Pedsa_1171Help
Entry
Pedsa_1171        CDS       T01430                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
psn  Pedobacter saltans
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:psn00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386614..1388971)
Genome map
AA seq 785 aa AA seqDB search
MENLSDQIFEKINAYWRAANFLAVGQIYLQDNVLLKEPLKPEHIKPRLLGHWGTSPGLSL
IYVHLNRLIKDTGAAILYICGPGHGAPAIVANTYLEGTYSEVFPNVSQNEEGMRKLCRQF
STPGGIPSHVSAHTPGSIHEGGELGYSLVHAFGAAFDNPELLVACVVGDGEAETGPLEGS
WKSIAFLNPKRDGAVLPILHLNGYKIAGPTVLSRMKDADLEELFKGYGYEVFFVEGDDPM
SVHKQMAVTLNLTYQKIKNIQHQARINNSASKAKWPMIILRTPKGWTGPKEWDGVPIEGT
FRAHQVPLTGVKENPEKLKLLENWMRSYEPQNLFDQNGRLIPELEELAPKGNNRMSALVY
ANGGLLFKSLVLPDFKKYALDVFTPGTVEAESTRNLGKYLRDIFTLNQETQNFRLFCPDE
TSSNRLEAVFEVTDRCTMEEILPKDENLAHDGRVMEVLSEHLCEGWLEGYLLTGRHGLFP
CYEAFVTIVDSMFSQHAKWIKTARELSWRKPVASLNYLLTSHVWRQDNNGYSHQGPGFID
TVVNKKSSVIRIYFPPDANTLLSVMDHCFRSKDYVNVIVAGKQPELQWLSMADAIAHCNQ
GASNWKWAGTDHDQQPDVILGCAGDVPTLEAVAAAWILRKELPDLKVRLVNVIDLMALSP
VAYHPHGMSEELFLDLFTAGAPVIFAFHGYVRIIHDLVHGRPDPARFHVRGFMEEGTTTT
PFDMVVLNQMSRYHLAMEAVKRVPRMHNRVDDFIRHCETKLKEHQVYICAHLDDMPEVKN
WKWSE
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatctatcagatcaaatttttgaaaaaataaacgcatactggagggcagctaac
ttcctggcggtcggacagatttatctgcaagataacgttttattaaaagagcctttaaaa
ccggaacatataaagccgcgtttattaggtcattggggcacatctccgggcttaagtctg
atttatgtacatcttaacagacttataaaagataccggcgcagctatactttatatttgt
ggcccgggacatggggctcctgctatagtagcaaatacctatcttgaaggaacttattcc
gaggtatttccaaacgtatctcagaatgaagaagggatgcgtaaattgtgccggcaattc
tcaactcccggaggaatacccagccatgtgagtgcgcatacgccgggatctatacatgaa
ggtggtgagctcggttattcgttggtacatgcgtttggagcggcatttgataatcccgaa
ttattggttgcctgtgtagttggagatggtgaggctgaaaccggtccgcttgaaggtagc
tggaaatctatcgcttttttaaatcccaaaagagatggtgcagtgctacctatattgcat
ttaaatggatacaaaatagcaggtccaacagtactgtcccgaatgaaagatgctgatctt
gaagaactttttaaaggctatggatatgaagttttttttgtagaaggtgacgatccaatg
tctgttcataaacaaatggcagttacccttaatctcacttatcaaaagataaaaaatatt
caacatcaggcaagaataaataacagtgcttctaaagctaaatggccaatgattattttg
aggacacctaaaggttggacaggaccaaaagagtgggatggggtgccaatagaaggtact
tttagagcccatcaggttcctttaaccggagtgaaggaaaatcctgaaaagctaaagcta
ttggaaaattggatgcgtagctacgaaccgcaaaatttgttcgatcaaaatggaaggctg
attcccgaattagaagaattagcgccaaaagggaataacagaatgagtgcgcttgtttac
gccaatggtggactcttgtttaaatcgcttgtgctgccagactttaaaaaatatgcgctg
gatgtttttacaccgggtacagttgaagccgaaagtacgcgtaatttaggtaaataccta
cgcgatatttttacgctaaatcaggaaactcaaaattttcgtctgttctgtccagatgaa
acctcttccaatcgcttggaagctgtatttgaagttaccgaccgttgtaccatggaagaa
attcttcccaaagacgaaaatttagcacatgacggtcgggtgatggaagtgctaagtgag
catctttgcgaggggtggttggaaggctatctgcttaccggtagacatggactttttcca
tgctacgaagcttttgtgactattgtggattctatgtttagccaacatgcaaaatggata
aaaactgcccgggaattaagctggcgaaagcctgttgcctctttaaattatttattgact
tcgcatgtgtggcggcaagataataatggctacagtcatcagggacctggatttatagat
acagtagtgaataagaaaagttcggtaatccggatttattttccaccagacgcgaatacg
cttttgtcggtaatggaccattgttttagaagcaaagattatgtaaatgttattgtggct
gggaagcagcctgaactgcaatggttaagtatggctgatgccattgcgcattgtaaccag
ggagcttcaaattggaagtgggccggaacagatcatgatcaacaacccgatgttattttg
ggctgtgccggagacgtacctactttagaagctgttgctgctgcgtggatattgagaaag
gaactgccggatttaaaagtgcgtctggttaatgtgattgatctgatggctttatctccc
gtagcctatcatccgcatggaatgagtgaggaattgtttttagacttatttacagcaggt
gcgcctgtgattttcgcctttcatggttatgtacgcatcattcatgatctggttcatgga
cggcccgatcctgcccgtttccatgttaggggatttatggaggaagggacaaccacaact
ccttttgatatggtagtattaaaccaaatgagccgctatcatttggctatggaagcggtt
aaaagagttcccagaatgcacaatcgggttgatgatttcattagacattgtgaaacaaaa
ctaaaagagcatcaagtttatatctgtgcgcatcttgacgacatgcccgaagttaagaat
tggaaatggagcgaatag

DBGET integrated database retrieval system