KEGG   Pedobacter saltans: Pedsa_1395Help
Entry
Pedsa_1395        CDS       T01430                                 

Definition
TspO and MBR-like proteins (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psn  Pedobacter saltans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647531..1648325)
Genome map
AA seq 264 aa AA seqDB search
MNRLQKLFQEKKENILSIYFTAGYPELDATLRIAEKLEAAGADFLEIGFPYSDPVADGPV
IQASSQRALENGMTVKVLFEQLKDLRKRVNIPILLMGYVNPMIQYGVKEFCTKAREVGVD
GIIVPDLPMYEYEELYKNDFLDNGLSNIFIVTPQTSEERIRKIDDLSSGFIYLLSSSATT
GSALDVSDKITSYYERVKSMNLKNPLIIGFGISDNQSFMRASKYANGAIVGSAFVKTLKA
DGSDYLSHIDGFINNIRSRNASSN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacagattacaaaagctttttcaagagaaaaaagagaatattctatctatatatttt
acagcgggatatcctgagctggatgctacactaagaatagccgaaaaactagaagctgca
ggagcagactttctggaaataggtttcccatattcagatcccgtagctgatggaccggta
attcaggccagttcgcaaagagctttagagaatggaatgacagtcaaagtccttttcgaa
cagctaaaagacttacgcaaaagagtaaacattcctattttattaatgggctatgttaat
ccaatgattcaatatggagttaaagaattttgtacaaaagcccgtgaagttggggttgac
ggcattatcgttccggatttaccaatgtatgaatacgaagaattatacaaaaatgatttt
ctggacaacggtttaagcaatatttttatagtaacgccgcaaacctcagaagaacgaatc
cgaaaaattgatgatttgtcatctggatttatttatctgttgtcatcttctgctactacg
ggaagtgccttagatgtgtcagataaaattacttcatattacgaaagagtgaaatcaatg
aatttgaaaaaccctttaattattggttttggaatttcagataatcagtcttttatgcgg
gcaagtaaatatgcaaatggagcaatcgtaggatctgcatttgtaaagactttaaaagcc
gatggcagtgattatctatcgcatatagatggcttcattaataatattcgttctcgtaac
gcatcaagtaattaa

DBGET integrated database retrieval system