KEGG   Pedobacter saltans: Pedsa_1401Help
Entry
Pedsa_1401        CDS       T01430                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psn  Pedobacter saltans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pedsa_1401
DNA repair and recombination proteins [BR:psn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pedsa_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652721..1653338)
Genome map
AA seq 205 aa AA seqDB search
MNFSSKLLENAVEEFSKLPGVGKKTALRLVLHLLKNSSAEVHQFSNSLTTLKDNIKYCQK
CHNISDNNVCEICLSPKRDSTIICVVEDTRDVMAIENTHQYQGLYHVLNGLISPMDGIGP
ADLTIESLLERIKSGEIQEIIFALSATMEGDTTIFYLHKKLKDFNIKISTIARGIAFGGE
IEYADEITLGRSIATRVPYENTLMK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcctctaaactattagagaacgcagttgaagagttttccaaattgcccgga
gtaggtaagaaaacagctttacgtttggtgcttcatttactgaaaaatagctcggctgaa
gtgcatcaattcagtaacagtctcactacgctaaaagacaatattaaatattgtcagaaa
tgccacaatatttctgataataatgtgtgcgaaatctgcctttcaccaaaaagagattcc
acaataatctgtgtggtagaagatacgagggatgtaatggctatagaaaatacgcaccaa
tatcagggattatatcatgtattaaatggcctgatttcgcctatggatggcattggcccg
gcagatttgacaatagaatctctcttggagagaataaaatcaggagagatccaggaaatt
atttttgcccttagtgcgacaatggaaggcgatactaccattttctacctgcataaaaaa
ttgaaagattttaatattaaaataagcacaattgcaaggggaattgctttcgggggagaa
atagaatatgcagatgaaataactcttggaagatctattgcaaccagagtaccttacgaa
aacaccctcatgaaataa

DBGET integrated database retrieval system