KEGG   Pedobacter saltans: Pedsa_1417Help
Entry
Pedsa_1417        CDS       T01430                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psn  Pedobacter saltans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pedsa_1417
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pedsa_1417
  Amino acid metabolism
   00310 Lysine degradation
    Pedsa_1417
Enzymes [BR:psn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pedsa_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1666703..1668088)
Genome map
AA seq 461 aa AA seqDB search
MAQYKFILPKMGESVAEATIINWLKKPGDAIEIDDTVLEVATDKVDSEVPSPVKGILIET
FFKENDVVQIGDVIATIEISEGDVEETAVKQEDELPIQNYNDIEEVEIPYIPSEEVDQIN
TSQNEYSDSNRFYSPLVKSIASEEGISLSELDSIQGSGADGRVTKDDLLAYVNKRNGKSY
PIEAQVSVTPEIRQAEAKDTKQSDRTEISVSEEKTYKQQHVVASSGSDEIIEMDRMRRLI
SDHMVMSKETSVHVTSFVEADVTNLVKWRDKVKSGFEKREGEKITFTPIFIEAIAKAIKD
FPMINISVQDNKIIKKKDINIGMAAALPNGNLIVPVIKNADQLNLVGLTKSVNDLGKRAK
VNKLAPDEIQGGTFTMSNIGMFGNIMGTPIINQPQVAILAVGVIKKKPAVIETEYGDVIA
IRHMMYLSMSYDHRVVDGSLGGMFLRKVADYLEQWDSDREI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacaaatttatattgccgaaaatgggggaaagtgttgctgaagcgacaatt
atcaactggctaaaaaagccgggagacgccatagaaatagacgatacggttttagaagtg
gcaactgataaagttgactcggaagttccgtctccggttaaagggatattgattgagacc
ttttttaaagaaaatgatgtagttcagataggtgatgttatagcgactattgaaataagc
gagggcgatgttgaagagacggctgtaaagcaggaagatgaactaccgatacaaaattat
aatgatattgaggaggtagaaattccatatattccttccgaagaggtagaccagataaat
actagccagaatgagtacagtgattcgaatagattttactcaccattggttaaaagtatt
gcatctgaagagggaatttctttaagcgaattggattcgatacaaggtagcggggcagat
ggtagagtaaccaaggacgatttattggcttatgttaataaaagaaacggaaaatcgtat
ccaatagaggctcaggtttctgttacacccgaaatcaggcaagcagaagcaaaagatact
aagcaaagcgatagaacagagatttctgtatcggaagagaaaacttacaaacaacagcat
gttgttgcaagttctggttcagatgagattatagagatggacagaatgagaagattgatt
tctgaccatatggtaatgagtaaagagacatcggttcatgttacctcatttgtagaagcc
gatgtgaccaatttagtgaagtggagagataaagttaaaagtggtttcgaaaaaagagaa
ggagagaagattacctttactccaatttttattgaagctatagcaaaagcaatcaaagat
tttccgatgattaatatttccgttcaggataataaaatcatcaagaaaaaagatataaat
attgggatggctgcagctttaccaaatggaaatctaattgtaccggttattaaaaacgcg
gatcagctgaatttggttggtttgacaaaatctgttaatgatttaggtaaacgcgcaaaa
gttaataaattggcaccggatgaaattcagggcggaacattcacgatgagtaatatagga
atgtttggtaatattatggggactcctataatcaatcaaccgcaggtagctattttagct
gtaggggttatcaagaagaagccagcagttatagaaactgagtatggggatgtaattgcc
ataaggcatatgatgtatttatccatgtcttatgaccacagggtggtagacggttcctta
ggaggtatgttcctgcgtaaggttgccgattatctggaacagtgggatagcgaccgggaa
atttag

DBGET integrated database retrieval system