KEGG   Pedobacter saltans: Pedsa_1513Help
Entry
Pedsa_1513        CDS       T01430                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
psn  Pedobacter saltans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pedsa_1513
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pedsa_1513
Enzymes [BR:psn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pedsa_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778771..1780345)
Genome map
AA seq 524 aa AA seqDB search
MKKYLSIIICFLGLFVGSTVLAQQDFNIIPYPNEIIIKKGKADLSKGVHITGNSNQTAYL
QKILIERGISNINIKKGIQINLLLTSKPSDISEAYELQASKNKIAIKAATEKGIFYGIQS
LNQLLLKSFEIPELIIKDEPAFKWRSFMLDDARYFHGKETVKKLLDEMALLKMNRFHWHL
TNDAGWRIEIKAFPLLTQIGSKRDSTQINDNGKKWKSEISDHKAHSGFYTQNDIKEIIAY
ASERQITIIPEISMPGHTSAAIASYSFLGTTKKQMKIPTRFGVESAVLDVSDERAKLFMY
QVLREVSALFPSPYIHIGGDEVKFDQWKNSISVQKYMDSHGIKNYYDLHVHFTNEVSKFV
EDSLGKRVIGWNEILGKNVHEWANEENANTSLSKNAIVQFWKGDAKDLLFGIDKGYEIIN
SDHRFTYLDYTYQQIDIKKAYGFNPVPDGLDNKQRKLVIGLGAQMWSEWTPTFKEISYQT
FPRIAAYAESGWTKQQNKDFVRFDKNIKTLINYWKSKGYNIPDL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacttaagtattattatatgttttctagggttatttgttggcagcaccgtt
ttggctcagcaagactttaatattataccctatccaaacgagataattataaaaaaagga
aaggccgatttgtctaaaggtgtgcatattacaggtaattccaatcaaacagcgtatttg
caaaaaatccttatagaaagaggtatttccaatattaatataaagaaaggaatccagata
aatctgttactgacatctaaaccgtctgatatttcagaagcttacgaactccaggcttct
aaaaataagatagctattaaagctgcgacggaaaagggaattttctatggtattcagagc
ttaaatcagttattgctaaaatcttttgaaattcctgagctgatcattaaagacgaacct
gcttttaaatggagatcatttatgttggatgatgcccgatatttccatggcaaagaaacg
gtaaagaaactgttggacgaaatggctttgttaaaaatgaacaggtttcattggcactta
accaatgatgctggctggagaatagagattaaggcatttccattattgacgcagataggt
tcgaaaagagatagtacacaaataaatgataatgggaagaaatggaaaagcgaaatttca
gaccataaagcgcatagcggtttttatactcagaacgatataaaggaaatcatagcttat
gccagtgaacgtcagattaccatcatacctgaaattagtatgcctggacatacttcagca
gcaattgctagttattcctttttaggtacaacaaaaaaacagatgaaaataccaacccga
tttggagttgaaagtgcagttctggatgtttctgatgaaagagcaaaactttttatgtac
caggttttaagagaggtatccgcgctttttccatctccgtatattcatattggaggtgac
gaagtaaagtttgatcaatggaaaaattctatatccgttcagaaatatatggatagccat
ggtattaaaaattattatgatcttcatgttcacttcaccaatgaggtatcgaaatttgtt
gaggattcgttaggaaaaagagtaataggatggaatgagatattgggaaaaaatgttcac
gaatgggcaaatgaagagaatgcgaatacttccttatctaaaaatgcgatagtacaattc
tggaagggagatgctaaagacttgttgttcggtattgacaaaggttatgaaatcatcaat
tcagatcacagatttacatatttggattatacttatcagcaaattgatataaagaaggct
tatggatttaatccggttccggatggtctggataataagcaacggaaattagtcattggt
ttaggagcacaaatgtggagcgaatggacgcccacatttaaagaaatatcttatcaaact
tttccccgcatagcagcgtatgcagaatctggctggacgaagcagcagaataaggatttt
gtaagatttgataagaatatcaaaacactgatcaactattggaaatctaaaggttacaat
atacccgatctttag

DBGET integrated database retrieval system