KEGG   Pseudopedobacter saltans: Pedsa_1746Help
Entry
Pedsa_1746        CDS       T01430                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00020  Citrate cycle (TCA cycle)
psn00640  Propanoate metabolism
psn00660  C5-Branched dibasic acid metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pedsa_1746
   00640 Propanoate metabolism
    Pedsa_1746
   00660 C5-Branched dibasic acid metabolism
    Pedsa_1746
Enzymes [BR:psn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pedsa_1746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF2711 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADY52303
UniProt: F0S841
Position
2032864..2034054
Genome map
AA seq 396 aa AA seqDB search
MNIHEYQGKEILKSFGVRVQEGIVVDTPEEAVEAAKKMKEDFGSDWVVVKAQIHAGGRGK
GGGVKLAKNLDEVKQRATDIIGMQLVTPQTGPEGKKVNKVLIAQDVYYPGESETKEFYVS
VLLNRSTGRNIIMYSTEGGMDIEEVAEKTPHLIFKEEIDPKVGLQPFQARKIAFNLGTSG
NAFKEMVKFITALYKAYDAIDASMFEINPVLKTSDDKILAVDAKVNLDENALYRHPDIAA
MRDITEEDPTEVEAGESNLNYVKLDGNVGCMVNGAGLAMATMDIIKLAGGDPANFLDVGG
TANAQTVKAAFNIILKDPNVKAILINIFGGIVRCDRVAQGVIDAYQEIGDIKVPIIVRLQ
GTNAEEAKKLIDESGLKVYSAILLKEAADLVSKVIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgaatatcaaggtaaagaaatattaaaaagttttggtgtgcgcgttcag
gaaggtatcgttgtggatactcccgaagaagctgtagaagcagccaaaaagatgaaagaa
gatttcggatctgattgggtcgttgttaaagctcaaattcatgctggtggacgcggtaaa
ggtggtggtgttaaattagcaaaaaacttagacgaagtaaaacaaagagctactgatatt
ataggaatgcagttggttactccgcaaactggtcctgaaggtaaaaaggtaaataaagtt
ttaattgctcaggacgtttactaccctggtgagtctgaaacaaaagaattctacgtatct
gtacttttaaatagatctaccggtagaaatattatcatgtattctactgaaggcggaatg
gacattgaggaagttgcagaaaaaactcctcatttaatctttaaagaagaaattgaccca
aaagtaggcctacaaccttttcaggcgagaaaaatcgctttcaacttaggtacttcaggc
aatgcttttaaagaaatggtaaaattcattactgctctttataaagcttatgatgcaatt
gatgcttctatgttcgagattaatccggtattaaaaacttctgatgataaaatacttgca
gttgatgctaaagtaaatttagatgaaaatgcactataccgtcatccggatattgctgct
atgcgtgatattacagaagaagaccctacagaagttgaagctggcgaatctaacctaaac
tacgttaaattagatggcaatgtaggctgtatggttaatggtgctggtttagctatggct
acgatggatatcattaaattagctggtggagatcctgctaacttcctggatgtaggcggt
actgcaaatgcacaaactgtaaaagcggctttcaacatcattttaaaagatccaaacgta
aaagcaatcttaattaacatttttggtggtattgttcgttgtgacagagtagcgcaaggt
gttattgatgcttaccaagaaattggtgatatcaaagttccaattattgtgcgtttacaa
ggaactaatgcagaagaagctaagaaattaattgacgaatccggattaaaagtttactct
gcaatcttattaaaagaagcagcagatcttgtttctaaggttatcgcataa

DBGET integrated database retrieval system