KEGG   Pedobacter saltans: Pedsa_1833Help
Entry
Pedsa_1833        CDS       T01430                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psn  Pedobacter saltans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pedsa_1833
   01230 Biosynthesis of amino acids
    Pedsa_1833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_1833
   00030 Pentose phosphate pathway
    Pedsa_1833
   00051 Fructose and mannose metabolism
    Pedsa_1833
   00052 Galactose metabolism
    Pedsa_1833
  Energy metabolism
   00680 Methane metabolism
    Pedsa_1833
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pedsa_1833
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pedsa_1833
Protein phosphatases and associated proteins [BR:psn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pedsa_1833
Messenger RNA biogenesis [BR:psn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pedsa_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2149182..2150162
Genome map
AA seq 326 aa AA seqDB search
MSKIKKIAVFTSGGDAPGMNACIRAVVRTGIHFGCEMVGIKQGYQGMIDKNFIPMNRYSV
SNIMQLGGTILKTARCLEFKTEEGQQKAYNNLKEAGIDALVAIGGDGTFTGAERLSKKFD
IPVICVPGTIDNDLYGTDFTLGFDTATNTVIEAIDKIRDTAESHDRLFFIEVMGRDAGCI
ALRAGIAGGAEAILLPEKATAIDDLITTLEDGAKNSKSSSIVIIAEGDKNGGAYNVAQKV
KEKISYFDTKVTILGHLQRGGSPSSFDRILGSRMGFAAVKAILAGETRKMVGLKGNNISF
TDLEESITRHDFKLEDDLMEMSTILA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaataaaaaaaatagcagtatttacctcaggaggcgacgcaccaggcatgaat
gcttgtataagagctgttgtgagaacaggaatacatttcggttgcgaaatggtaggaata
aaacaaggttatcagggtatgatagacaagaattttattcctatgaatagatattctgtt
agcaacatcatgcaattgggtggaactatccttaaaactgctcgttgtttagagtttaag
accgaagaagggcaacaaaaagcttataacaatttaaaagaagccggtatagatgctttg
gttgcaattggcggtgacggaacttttacaggagcagaaagattatctaagaaattcgac
attcccgtaatctgtgtaccaggaacaattgacaacgatttatacggaaccgattttact
ttaggttttgatacagccacaaatacagtaattgaggctattgacaaaatcagagataca
gcagaatcgcatgacagattattctttattgaagtaatgggcagagatgctggctgtatc
gcacttagagccggaattgctggtggcgcagaagctattttattacccgagaaagctacc
gctatagatgatttgattaccacattggaagatggtgcaaaaaattccaaatcatcaagt
atagttatcatagccgaaggtgataaaaatggcggtgcatataatgtagcacaaaaagta
aaagaaaaaattagctacttcgacacaaaagttactatcttaggccacttacaaagaggc
ggcagcccaagtagttttgataggattttgggaagtagaatgggctttgcagctgttaaa
gcaattcttgccggagaaactcgtaaaatggtcggtctaaaaggaaacaatatcagtttc
actgacttagaagaatctattacgagacatgactttaaactggaagatgacttaatggaa
atgtcaaccatattagcgtaa

DBGET integrated database retrieval system