KEGG   Pedobacter saltans: Pedsa_2019Help
Entry
Pedsa_2019        CDS       T01430                                 

Definition
glutathione peroxidase (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psn  Pedobacter saltans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pedsa_2019
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pedsa_2019
Enzymes [BR:psn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pedsa_2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2365091..2365606)
Genome map
AA seq 171 aa AA seqDB search
MENTVYQFRVRTGFGAEVQLDAFKDKVLLIVNTASQCGFTSQLKELVQLKTFFDDEPFEI
LAFPSNDFGAQEPLNDEEIQKFCETEFQTNFPVFSKLKVRGANIHPLFSFLSDKKRNGFT
GVSPKWNFHKYLVNHKGEVIDFFYPFTKPNSSKIKKKIRKILAEMGVLRSF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacagtttatcaatttagagtgagaaccggttttggagcagaggtacaatta
gatgcgtttaaagacaaggtactgttgattgtcaatactgcttcgcaatgtggtttcaca
tctcaattgaaagaattggttcagttaaaaactttttttgatgatgaaccatttgaaatt
ttggcttttccaagtaatgattttggtgcgcaggaaccattgaatgacgaggagatacaa
aagttttgcgaaacagagtttcaaaccaatttcccggtttttagtaaattaaaagttcgt
ggtgcgaacatacatccgctttttagtttcctgtcggataaaaagagaaatggctttact
ggtgtttcacctaagtggaactttcataaatacctggttaaccataaaggcgaggtgatt
gatttcttctatccttttacaaaaccaaacagttcgaagattaagaaaaaaataagaaag
atattggcggaaatgggcgttttaaggtcattctag

DBGET integrated database retrieval system