KEGG   Pseudopedobacter saltans: Pedsa_2042Help
Entry
Pedsa_2042        CDS       T01430                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00900  Terpenoid backbone biosynthesis
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01130  Biosynthesis of antibiotics
Module
psn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pedsa_2042
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pedsa_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADY52594
UniProt: F0SAH4
Position
complement(2394202..2395005)
Genome map
AA seq 267 aa AA seqDB search
MICFPNAKINIGLNVINKRQDGYHELETIFYPVKIKDALEIIEAPEMKFESSGINIPGDS
NNNLCIKAYNLLRADFDLPNIHIHLHKHIPIGAGLGGGSSDATFFIKLVNDKFNLGMDKE
VMKNYCSKLGADCAFFLENRPVFATGIGDVFDEVEVDLSGYHVVLVKPPVHVATAEAYKN
VVPQEPINSLKSLVRLPVEDWNCNIKNDFEPHIINSYPQIRMVKANMLDIGAVFALMSGS
GSSVFGIFNEKPDLSKFEEDFDVFYDI
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcttccccaatgccaagattaatatcgggcttaacgtgataaataaaagacaa
gacggttatcatgaactggagactatcttttatccggttaagattaaagatgcgttagaa
ataatagaggctcccgaaatgaagtttgaaagctctggaatcaatatacctggggactcc
aataataatttatgtattaaggcttacaatctgttaagggctgattttgatcttcctaac
attcacatccatctgcataaacacattccaataggagctggcttaggaggtggatcttca
gatgctactttttttattaaactggttaatgataagtttaatctggggatggataaagag
gtcatgaaaaactattgtagcaaactgggggctgattgtgctttttttctggaaaacaga
ccggtatttgctactggtattggcgatgtatttgatgaagtggaggtggatctttcggga
tatcacgttgttttggtaaaaccgcctgtccatgtagcaacagcagaagcgtacaagaat
gttgtaccccaggagccaataaattcgcttaaatctctggttcgtttgcctgttgaagat
tggaattgcaatatcaagaacgactttgaaccacacattataaattcatatccacaaatc
aggatggtgaaagctaacatgcttgatatcggggcagtttttgctttaatgagcggaagt
ggatcttctgtttttggtatatttaacgaaaaaccagacctgagtaagtttgaagaggac
tttgatgttttttacgatatttaa

DBGET integrated database retrieval system