KEGG   Pedobacter saltans: Pedsa_2045Help
Entry
Pedsa_2045        CDS       T01430                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psn  Pedobacter saltans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2396414..2396902
Genome map
AA seq 162 aa AA seqDB search
MTVSIIVAIDENKAIGKNNQLLWHLPNDLKFFKKTTSGHTIIMGRKTFDSIGKALPNRRN
IVISRNKNLKIEGAEVYSSIDQALNTCKNEQEVFIIGGAEIYKQAEPITDKFYITKVHHQ
FDADTFFNNLNLNELNEIWREENHADERHLYDYTFLILEKRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaagcattattgttgctatagatgagaataaggctattggaaaaaacaaccag
ttgctctggcatttacccaacgacctcaagttttttaaaaagacaacttcgggacatacc
ataattatgggtagaaaaaccttcgattctattggaaaggctcttcctaacagacggaac
attgttatttccagaaataaaaatctaaaaatagagggtgcagaggtttacagttctata
gaccaagctttaaatacctgcaaaaatgaacaggaagtatttattataggtggcgcagaa
atatataaacaggcagaacctattaccgataaattttatataacaaaagtgcatcatcag
tttgatgcagatacattttttaataacctaaacctaaacgaattgaacgaaatatggaga
gaagaaaatcacgctgacgagcgacacctttatgactacacttttctgattctggaaaag
agaaaataa

DBGET integrated database retrieval system