KEGG   Pedobacter saltans: Pedsa_2721Help
Entry
Pedsa_2721        CDS       T01430                                 

Definition
mannitol dehydrogenase domain-containing protein
Orthology
K00041  
tagaturonate reductase [EC:1.1.1.58]
Organism
psn  Pedobacter saltans
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:psn00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3252287..3253786)
Genome map
AA seq 499 aa AA seqDB search
MELLSREQLKTKNSNLICPPVSTLELPEKVLQFGTGVLLRGLPNYYINKANLEGNFNGRV
VVVKSTDQGGTNDFDQQNNLYTICIRGIQNGEKKEENQLVSAISRVLTASNQWEEILDFA
ASPSLEVVISNTTEVGICLEEDNVHSQPPVSFPGKLLAVLYHRYKMYNGSKDRGLVIVPT
ELIPDNGTKLKEIIIELALQNQLPEDFITWLETCNHFCNSLVDRIVPGKPHADMKQPLEQ
ELGYKDQLLIMSEVYSLWAIEGNEKVKDVLSFAKSDSGVVVTPDIGLHRELKMRLLNGTH
TLSSGIAFLSGFSTVKLAMDDSDVFAYVENLMKQEIAKSIPYEVDEQMAIDFADNVIDRF
KNPHIEHKWISITMNYTSKLAMRVIPLLLNYVKKFNSVPELMALGFAAYIAFMNGYEKDG
KYYGEVDGEEYPINDDKAAQVIALWDKNGREGVVKAILSNQKLWGTDLTEIEDFEMVVNG
YLQNILDQSVLSALNSQTV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggagttattaagtagagagcagctaaaaacaaaaaacagtaatttgatttgtccccca
gttagcaccctggagttaccagaaaaagttttgcagtttggaactggagttttgttgaga
ggattacctaattattatattaataaagcaaatttagaaggaaactttaacggacgtgta
gtcgtagtaaagtcaactgatcagggcggtacaaacgattttgatcaacaaaataattta
tacactatttgcatcagaggaattcaaaacggagagaaaaaagaggagaatcagctggtt
tctgcaataagcagggtacttacggcgagtaatcaatgggaagaaattctggattttgca
gcaagtcccagtttagaagtagtaatatccaacaccacagaggtaggcatttgtttagaa
gaagacaatgtacacagccagccaccggtttcttttcccgggaaattattggcggttctt
taccatcgttataaaatgtacaacggttctaaagacaggggcttggtaatagttccaaca
gagctgattccagataacgggacaaaattaaaagagattattattgagctggcacttcaa
aatcaacttcctgaagattttattacctggcttgagacatgtaatcatttttgtaattca
ctggtagatagaatagtgcctggaaaacctcatgctgatatgaaacagcctttagaacaa
gaattgggttataaagaccagctgttgattatgtctgaagtttatagcttatgggctatc
gaagggaatgaaaaagtaaaagatgttttgagttttgcgaagtctgattcgggtgttgta
gttacaccggatataggtttacatcgtgaactaaaaatgcgattgttgaacggaacacat
acattaagcagtggtattgcttttttatctgggttttcaaccgtgaaactggcaatggac
gattccgacgtttttgcatatgtagagaatttgatgaagcaggaaattgccaaatctatt
ccttatgaggttgatgagcagatggcaattgattttgcagataatgtgatagatcgtttt
aaaaatccacatatcgagcataaatggattagtataactatgaactatacttctaagtta
gctatgcgtgttattcccttgttgctaaattatgtaaagaaatttaattcggttcctgaa
ttaatggcattaggttttgctgcttatatcgcatttatgaatggttatgagaaagatggc
aaatactatggagaagtagacggcgaagaatatccaattaatgatgataaagctgcacag
gtaatagcgttgtgggataaaaacggaagagaaggtgtagttaaagcgattctgagtaat
cagaaattgtggggtaccgatttaacagaaatcgaagactttgaaatggtagtaaacggt
tatttacaaaatatattagatcaatctgtattgtcggcattaaatagccagacagtgtag

DBGET integrated database retrieval system