KEGG   Pedobacter saltans: Pedsa_2854Help
Entry
Pedsa_2854        CDS       T01430                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psn  Pedobacter saltans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pedsa_2854
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pedsa_2854
Enzymes [BR:psn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pedsa_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3399331..3400113)
Genome map
AA seq 260 aa AA seqDB search
MNILDKIVARKKEEVVEAKKKYTIQDLEKSFSFHRETYKLTDFLKDPSKTGIIAEFKRKS
PSKGIINDKVSVEQVTTGYASAGASALSVLTDKDFFMGHEDDLIAARKVNGIPILRKDFM
VDEFQIIEAKAIGADIILLIAACLTAEETKRFAELAKSLGLSTLLEVHGQDELDYSLNQY
IDVVGVNNRNLKDFSVSVETSLQLAETIPTEFLKISESAISNPETVKMLKKAGFDGFLIG
ENFMKTSDPAQAMRDFVALI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgataaaattgtagccaggaaaaaggaggaagttgttgaggcaaagaag
aaatatactattcaggatctggaaaaaagcttttcgttccacagggaaacctataagctg
acagatttcctgaaagatcctagtaaaactggtataattgcggagtttaaaagaaaatct
ccatcgaaaggaattatcaatgataaggtttctgtagagcaagttaccaccggatatgca
tcggcaggcgcatcggctttatcagttttaacggataaggatttcttcatggggcatgaa
gatgatttgatagcagcgagaaaagtgaatggtattcccattctacgaaaagattttatg
gtagatgagtttcagataatcgaggcgaaggctattggtgcagatattattttgttaata
gcagcttgtttaacagcagaggagactaagcgttttgccgaattagcgaaatctttggga
ttaagtactttgctggaagtacacggtcaggacgaattggattatagtttaaaccaatat
attgatgtcgttggtgtaaataacaggaatctcaaagatttttcagtgtcagtagaaaca
tccttacaattggccgaaactataccgactgaatttttaaagatttcggaaagcgcaata
agcaatccggaaacggtaaaaatgcttaaaaaagcaggatttgacggatttttaattggg
gaaaattttatgaagacctcagatccggctcaggccatgagagactttgtcgctctaatt
taa

DBGET integrated database retrieval system