KEGG   Pedobacter saltans: Pedsa_3001Help
Entry
Pedsa_3001        CDS       T01430                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psn  Pedobacter saltans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pedsa_3001
   01230 Biosynthesis of amino acids
    Pedsa_3001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3001
   00030 Pentose phosphate pathway
    Pedsa_3001
   00051 Fructose and mannose metabolism
    Pedsa_3001
   00052 Galactose metabolism
    Pedsa_3001
  Energy metabolism
   00680 Methane metabolism
    Pedsa_3001
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pedsa_3001
Protein phosphatases and associated proteins [BR:psn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pedsa_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3548009..3548983)
Genome map
AA seq 324 aa AA seqDB search
MISRINKIGILTSGGDSPGMNAAIRAVVRTALYYDLDVIGIRRGYEGAINGEFIEMDRKS
VANIIQRGGTILKTARSQAFQTPEGRKKAYDQIKAQGIDALVVVGGDGTFTGAKVFGEEF
DIPIIGLPGTIDNDLYGTDFTIGYDTAINTAVDAVDKIRDTAESHDRVFIIEVMGRDCGL
IALRSGIGVGAEAILIPETKTDVPHLLHRMEVGRKDKSSKIIMVAEGGEGAFKLGEIIKE
RFPHYDTRVSVLGHIQRGGKPTCMDRVLASRLGVAAVEGLLEGRRDVMAGLIHGKVEFTP
LDHAIKHNKEVNESLLKIVEILSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattagcagaataaataaaatagggatacttacttctggaggggactctccgggcatg
aatgcggcaattagggcggttgtacgtacagcattatattatgatttggatgttataggt
ataagaagaggatacgagggagcaatcaatggtgaatttattgaaatggaccgaaagtct
gtagctaatattatccaaagaggaggaactatactcaaaaccgcaagaagccaggcgttc
caaacgccggaggggagaaaaaaagcttacgatcaaattaaagctcagggaatagacgct
ttggttgttgtaggtggagatggtacttttaccggggcaaaggtttttggcgaggaattc
gatattccaattattggtttgccgggaacaattgataacgatttgtacggaacagatttt
acaattggttatgacacagcgataaatacagccgtggatgctgtagataaaatcagggat
accgccgaatctcatgatagggtttttataattgaggtaatgggacgtgactgtggttta
atcgcgttaaggagtggtattggtgttggtgccgaggctattttgattcctgagacaaaa
actgatgttccgcatttgttgcacagaatggaagttgggcgtaaagataaatcttctaaa
attattatggttgcagaaggtggagagggagcttttaagttgggagaaattattaaagag
agatttccacactacgataccagggtgtctgtgctaggacatattcagagaggcggaaaa
cctacttgtatggatagagttttggctagtcgtttaggtgtagctgccgtagaaggattg
ttagaaggaagaagagatgtaatggcgggattaattcacggaaaggtagaatttacaccg
ctggaccatgcaattaaacataacaaagaggttaacgaaagcttattgaaaattgttgag
attctatctctataa

DBGET integrated database retrieval system