KEGG   Pedobacter saltans: Pedsa_3077Help
Entry
Pedsa_3077        CDS       T01430                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
psn  Pedobacter saltans
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:psn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:psn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3650169..3651659
Genome map
AA seq 496 aa AA seqDB search
MQALLEHMFGNKLFKTEMNRKLGFFLGVALVAANVGFAQNVASKKVKVFTTAKDTKLRIS
ENGTLSFSPNAQPFETEATVFIDADRTFQTMIGIGGAITDASAETYAKLPKALQQEFLKA
YYSKTEGIGYNLARTNINSCDFSSYSYTYVKDNDKELKTFNIAPEEKYRLPLIKAATAMA
GGTLPLYVSPWTPPAWMKDNNNMLQGGKLLPEYRQAWANYYIRYIQEYEKRGLPIWGLTV
QNEPMAKQRWESCIFTAEEERDFIKEYLGPTLHKAGMANKKLIAWDHNRDQVYQRASTIL
GDKEAAKYVWGIGFHWYETWTKSDMQFYNLRNVKEAFPEKELIFTEGCKEKFDMDSIYNW
SLGERYGYSMINDFNAGTAAWTDWNILLDETGGPNHVKNLCFAPIHADTKNKKLIYTNAY
YYLGHFSKFIQPGAKRIITSPSRDVLETTGFVNPDGKIVVVVMNKTSNDMPYQLWLKGYA
AKTTSKAHSISTYIID
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctctgttggaacatatgtttggtaataaattatttaaaacagaaatgaataga
aaattaggtttttttcttggcgttgcattggttgcggcaaacgttggttttgcccaaaat
gtagcttcaaagaaagttaaagtttttacgacagcgaaagatacaaaattgcgtatcagc
gaaaacgggacattaagtttttctccaaatgcacaaccttttgaaacagaggcgacagtt
tttatagatgcagacaggacctttcagacgatgatagggattggaggagctattacagat
gcgtctgcagaaacttatgctaagcttccaaaagcattacaacaagagtttttaaaagcg
tattacagcaaaacagaaggtattggctataatttagcgagaacgaacatcaatagctgc
gatttttcctcctacagctatacttatgtaaaagataatgataaggagctgaaaacattc
aacattgcgcccgaagaaaaatacagactgcctttgattaaagcggcgacagcaatggcc
ggcggaactttacctttgtatgtaagtccatggactccaccagcctggatgaaagataac
aataacatgttgcagggcggtaaattgcttcccgaatatcgtcaggcttgggcaaattac
tatatcaggtatattcaggaatatgaaaaaagaggactacccatttggggcttaacagtg
cagaacgaaccaatggcgaaacaaagatgggagtcttgcatttttacagcggaggaagaa
agagattttattaaagaatatttaggccctactttacataaagccggaatggcgaataaa
aaattaatcgcctgggatcacaatcgcgatcaggtttatcaaagagcaagtaccattctt
ggagataaagaagccgctaaatatgtttggggaattggtttccattggtacgaaacatgg
acaaaaagcgatatgcagttctataaccttagaaatgttaaagaggcgtttccagagaaa
gaattgatatttaccgaaggatgtaaagaaaagttcgatatggacagcatttacaactgg
tccttaggcgaaaggtatggatattctatgattaacgactttaacgcaggtacagccgct
tggacagactggaacattttattggatgaaacgggtggaccaaatcatgttaaaaacctt
tgtttcgctccgatacatgcagataccaagaataaaaaattgatctataccaatgcgtat
tattatttaggtcacttctcaaaattcattcagccaggagcaaagagaataattacctcg
ccatccagagatgttttagaaactacgggatttgttaatccggacggaaaaatagttgtt
gtagtgatgaataaaacgtccaacgatatgccttaccaattgtggttaaaaggatacgcg
gctaaaacgacaagtaaagcgcattcaataagtacttatatcattgattaa

DBGET integrated database retrieval system