KEGG   Pseudopedobacter saltans: Pedsa_3117Help
Entry
Pedsa_3117        CDS       T01430                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00020  Citrate cycle (TCA cycle)
psn00620  Pyruvate metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3117
   00020 Citrate cycle (TCA cycle)
    Pedsa_3117
   00620 Pyruvate metabolism
    Pedsa_3117
Enzymes [BR:psn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pedsa_3117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF2118 PYNP_C GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADY53656
UniProt: F0SAN5
Position
complement(3706757..3708379)
Genome map
AA seq 540 aa AA seqDB search
MAEAIRMPKMSDTMTEGVLAKWHKKVGDQIKAGDVVAEVETDKATMDFESFQEGTLLYIG
VEEGQAVPVDAVIAVIGAEGEDYKSVLNADSGAAAPASKEEAPAEEAAEDKDGGAEDVDL
SSIPAAVIRMPLLSDTMTEGVINKWNFKVGDKVKSDDSLADVETDKATMEVVGYEEGTLL
YIGVEEGKAAKVNDIIAIVGEEGTDITPLLKAGNPGTKKEKKEESAKETASAPAESAKEV
TSSNTDSRIKASPLAKKLAEEKGINLSEVKGSAEGGRIVKKDVEGFTPSTKEVAAAAEAP
KEEKGFTIPTYVGEERYTEQPVSQMRKVIARRLGESLFTAPHFYLTVSVDMDNAMAARTQ
INAIAPVKVSFNDIVIKAVAVALKQHPAVNSSYRGDKIRFNEHTNIGVAMAVEDGLLVPV
VRFADGKSLSHISAEVKEYAKKAKAKKLQPSDWEGSTFTVSNLGMFGIDEFTSIINSPDG
AILSVGAIQQVPVVKNGAVVPGNIMKLTLGCDHRVIDGATGAAFLQTLKSLIEEPIRLLA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaataagaatgcctaaaatgagcgacaccatgaccgaaggtgttttggct
aaatggcataaaaaagttggtgatcaaattaaagctggtgacgtagttgctgaagtggaa
acagataaagcaactatggattttgaatcctttcaggaaggtaccttgctatatattggt
gttgaggaaggacaggctgttcctgtagatgcggttattgctgttatcggagccgagggc
gaggactataaatcagttttaaatgctgatagcggtgctgctgctccggcatcaaaagaa
gaagctcctgctgaagaagcagctgaggataaagacggtggcgctgaagatgtagattta
tccagtattcctgcggctgttatccgcatgcctttgctaagcgacaccatgacagagggt
gttatcaataaatggaattttaaagttggagacaaagttaaatcagacgattctttagct
gatgttgaaaccgataaagcaacaatggaagttgttggttacgaagaaggaactttatta
tacattggtgttgaggaaggtaaagcagcaaaggtaaacgatattatcgctattgttggt
gaggaaggtactgatataacacctcttttaaaagccggaaaccctggtactaaaaaagag
aaaaaagaagaatctgcgaaagaaaccgcatcagctcctgcagagtcagccaaagaagta
acttcttctaacactgacagcagaattaaagcttctcctttggctaagaaactggctgaa
gaaaaaggcatcaacttaagcgaagtaaaaggaagtgctgaaggcggaagaattgtaaag
aaagacgttgaaggattcactccttctactaaagaagttgcagctgctgccgaagctcct
aaagaagagaaaggatttactatcccaacttacgttggtgaagaaagatatacagagcaa
cctgtttctcaaatgagaaaagttatcgctcgtcgtttaggcgaaagcttattcacggct
ccgcacttctacttaacagtaagtgttgatatggataatgcgatggctgcccgtacgcaa
attaatgctattgctcctgtaaaagtttcatttaacgatatcgttattaaagcggttgcc
gttgcattgaaacaacaccctgctgtaaactcttcttacagaggcgacaaaatccgtttc
aatgagcatactaacattggtgttgctatggctgttgaggatggcttattggttcctgta
gttcgctttgcagatggcaaatctttatctcacatctctgctgaagttaaagagtatgct
aaaaaagcaaaagctaagaaattacaaccttcagattgggaaggaagcacatttacagtt
tccaacttaggtatgtttggtattgacgaatttacttcaattatcaactctcctgatggt
gcaatcctttcggtaggtgcaatccaacaagttcctgttgttaaaaacggagctgttgtt
ccaggaaacatcatgaaattaactttaggttgcgaccatagagtaattgacggtgctact
ggtgctgctttcttacaaaccctaaaaagtttaattgaagagcctatcagattattagca
taa

DBGET integrated database retrieval system