KEGG   Pedobacter saltans: Pedsa_3164Help
Entry
Pedsa_3164        CDS       T01430                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
psn  Pedobacter saltans
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Pedsa_3164
  Lipid metabolism
   00600 Sphingolipid metabolism
    Pedsa_3164
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Pedsa_3164
Enzymes [BR:psn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Pedsa_3164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3770541..3772994
Genome map
AA seq 817 aa AA seqDB search
MMRIPGYFSIFLLFLTTSLSAQQRKEFYLNKGWKFAKDDFQQATANDFNDKNWEQVVVPH
DWAIKGPFDRNNDLQVVKIVQNGEKVASEKTGRTGGLPYIGIGWYRLDLPLQQLKSGERV
FLKFDGAMSNAQVFVNGKEATHWPYGYNAFHAEVTDLLKQGTTNKLAVRLENKEQSSRWY
PGAGLYRNVHLIITQDVHIPIWGTYLTTPSVRKELASVRLQTKIAGLKEGEKANIKLETD
ILDANGKVVISKATSDNLERASIDQHFLLKNPQLWSPESPVLYKAVSKLYKDGVLKDTYE
TTFGIRTVMFNAENGFTLNGVKRKFQGVCNHHDLGPLGAAENEAALRRRLLMLKDMGADA
IRTAHNMPSPELVKLCDELGIMLIVESFDEWKAPKMKNGYNQLFDQWVEKDLINMIHANR
NSPSVILWSIGNEVPDQGTPNGVEIAARLQDICHREDPTRLVTVGMDKIDAVLKNGFAAV
LDLPGFNYKPSRYAEAYKVLPQGFILGSETASTVSSRGVYKFPVKTGPDLIYPDNQSSSY
DMEHCAWSQTPDDEFIAQDKLDYTIGEFVWTGFDYLGEPAPYESHWPSHSSYFGIIDLAG
IPKDRYYLYRSRWNTKEKTLHLLPHWTWPGREGEITPVFCYTNYPAAELFVNGKSMGVKK
KDDSDLFGRNRLMWNEVKYEPGNIKVVALDAAGNPVEERVISTAGKPYKIILEADRKMLK
ADGKDLGFITVTIVDANGNICPHADNEILANVKGSVSFKTIANGDPTNLQLFHEPHMKVF
SGKLVITVQSSELKGKGELTVSAKGLASAKIDFKIGD
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtattcccggatatttttcgatttttttattgtttctgacgacaagtctgagt
gcccaacagcggaaagagttttacttaaataaaggctggaaattcgctaaagatgatttc
caacaagctacggctaatgactttaatgacaaaaattgggaacaggttgtggtacctcac
gattgggcaattaaaggcccttttgaccggaataatgatttacaggttgtaaaaattgtt
cagaacggagaaaaagtggcttccgaaaaaacaggaagaaccggaggtttaccttatatc
ggaataggttggtacaggctggatttgcctttgcagcagcttaaatccggagaaagagtt
ttcctgaaatttgatggagcaatgagtaacgctcaggtttttgtcaatggaaaagaagct
acacattggccttatggctataacgcttttcatgcggaggttaccgatttgttaaagcag
ggcactacaaataaattagccgttcgtttagaaaataaagaacagtcttcccgttggtat
ccgggggcaggtttgtatcgcaatgtacatttaattataacgcaggatgtgcatattcct
atttggggaacctatcttaccacaccttcggtaagaaaggagctggcgagtgtaagatta
caaacgaaaattgctggtcttaaagagggagaaaaagcaaacataaagttagaaacagat
attcttgacgctaacggaaaagtagttattagcaaagctacatccgataatttagaaaga
gcatccatagatcagcattttttattgaaaaatccacagctgtggtctccggaatcacct
gtcttatataaagctgtttctaaactttataaagacggagttttaaaagatacctacgaa
actacatttggtatacgtaccgttatgtttaatgcagaaaatggatttacacttaatggc
gtaaagcgcaaatttcagggagtatgtaaccatcacgatttggggccattgggagctgca
gagaatgaggccgcgttacgcagaagactactcatgctgaaagatatgggagcggatgct
attagaacagctcataatatgccatctcccgaactggttaaactatgcgacgaattggga
attatgctgattgttgaatcctttgacgaatggaaagctccaaaaatgaaaaatggatac
aatcagttatttgatcaatgggtagagaaggatttaattaatatgatccacgctaaccga
aacagcccttcagttattctatggagcataggaaatgaagttccggatcagggaacaccc
aatggcgtagaaatagcggcaagattgcaggatatctgtcaccgtgaggatcctaccaga
ttagtaaccgttggtatggataaaatagatgcggtattgaaaaatggttttgctgcagta
ctcgatcttcctggttttaattataagccttccagatatgcagaagcttataaagtttta
ccacaaggctttatactaggatccgagacggcttcaacagtaagctccagaggtgtttat
aagtttccggttaagacagggcccgatcttatttatccggacaatcaaagctcttcttat
gatatggaacattgcgcctggtcacaaacacctgatgatgagtttatcgctcaggataaa
ttagattataccattggtgaattcgtttggaccggttttgattatttaggcgagccagct
ccatacgagtcccactggccttctcacagctcttatttcggtattattgatttggcaggc
atacctaaagaccgttattatttgtatcgctctcgttggaacacaaaggagaaaactttg
catttgttgccacattggacatggccgggaagagaaggcgaaataacgccagttttctgt
tataccaattatccggctgcagaactatttgtaaacgggaaaagtatgggagttaagaaa
aaagatgattcggatctttttggaagaaacagactaatgtggaatgaagtaaaatacgag
ccaggaaatataaaagttgttgcattggatgctgccggcaatccagtagaagaacgtgta
ataagcaccgctggtaaaccatataaaattattttagaagctgacagaaaaatgttaaaa
gctgatggaaaagatctgggatttattacagtaacaatagttgatgcaaatggaaatatt
tgccctcatgctgataacgagattctagctaatgttaaaggtagtgtaagctttaaaaca
atcgcaaatggtgaccctacgaatttgcaacttttccatgaaccgcatatgaaagtattt
agtggaaaactagttattacggttcaatcttctgaacttaaagggaaaggggagctaacg
gtttcagccaaagggttagcctctgcaaaaatcgactttaaaataggggattag

DBGET integrated database retrieval system