KEGG   Pedobacter saltans: Pedsa_3275Help
Entry
Pedsa_3275        CDS       T01430                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psn  Pedobacter saltans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pedsa_3275
Enzymes [BR:psn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pedsa_3275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3895084..3895668
Genome map
AA seq 194 aa AA seqDB search
MYEYIDGKLVYKCPTYIVLEATGIGYHINISLNTFSLVKDQEKCKLYTWLHVKEDGHTMY
GFADEGERRLFLHLISVNGVGPNTARMMLSSISPIEIEQAIIKGEVGLIKSIKGIGPKTA
QRLIIDLQDKLQKSGDGTLIAIRQDYTAREEAISALVMLGFAKNNAEKAVDSAVKKSDKI
LSVEEIIKIALKSL
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaatatattgacggcaagttggtttacaaatgtccaacttatattgttttagaa
gccacgggaattggataccatattaatatttcgttaaatacattttctcttgtaaaagat
caggaaaaatgtaaactctatacatggttacatgtaaaagaggacggccatactatgtat
ggctttgctgacgaaggtgagagacgtttgttccttcatttgatttctgtcaacggagta
gggccaaatacggcaagaatgatgctttcctctatttccccaatagaaatagaacaagct
attataaaaggcgaagtaggattgattaagtctatcaaaggaatcggccctaaaactgcg
caaagactgattatagatttacaagataagctgcaaaaaagtggtgacggaactttaata
gctatcaggcaggattataccgcccgggaagaagctatcagtgctttagtaatgcttgga
tttgcaaaaaataatgcggaaaaagctgttgatagtgcggtaaaaaaatcagataaaatt
ttgtcggttgaagaaataataaaaatagctttaaagagtttataa

DBGET integrated database retrieval system