KEGG   Pedobacter saltans: Pedsa_3343Help
Entry
Pedsa_3343        CDS       T01430                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
psn  Pedobacter saltans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:psn00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:psn00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3975054..3976385)
Genome map
AA seq 443 aa AA seqDB search
MSIITGETEFFKGIGKIQYEGKESKNPLAFRFYDENRIVGGKTMKEHLKFACAYWHSFCG
NGADPFGEPTHIFPWDAKKDPIERAKDKMDAAFEFITKMNIPYYCFHDVDVVDYGTDILE
NERRLQALVEYAQQKQKESGVKLLWGTANLFSNRRYMNGAITNPDFHVLTHGAAQVKAAI
DATIALGGENYVFWGGREGYMSLLNTDMKREKEHFAKFLHTVKDYARKNGFKGTFFIEPK
PCEPSKHQYDYDAETVIGFLRQYDLLNDFKLNLEVNHATLAGHTFQHELQVAVDAGLLGS
IDANRGDYQNGWDTDQFPNNINELVESMLIILSGGGLQGGGVNFDAKIRRNSTDPEDLFY
AHVGGMDIFAKALLVADEILSNSDYNKIRTERYASFDSGKGKEFEEGKLSLEDLKAYAIS
NGEPKMRSGKQEFLENVINNYIF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcattacaggagaaaccgaattttttaaagggattggaaaaattcaatatgaa
ggaaaagaatctaaaaacccattggcttttagattttatgacgaaaacagaatagttggc
ggtaaaacgatgaaagagcacttgaaatttgcttgtgcttattggcattcgttctgtggg
aatggtgcagatccttttggagaacctactcatatatttccttgggatgcaaaaaaagat
cctattgagagagcaaaggataaaatggatgctgcttttgagtttatcacgaaaatgaat
attccttactattgtttccatgatgttgacgtggttgattacggaacagatattcttgaa
aacgaaagaagactacaggctttagtagagtatgcgcagcagaaacaaaaagaaagcgga
gtaaaattactttggggtacagccaatttgttttctaacagaagatacatgaatggtgct
attaccaacccggattttcatgtattaacacatggcgctgcacaagttaaagccgcaatc
gatgctaccatagccttaggaggagaaaattatgttttctggggcggcagagaaggttat
atgtctttattaaatacggacatgaaacgtgagaaagaacatttcgcaaaattcttacat
actgtaaaagactatgctagaaaaaatggtttcaaagggactttctttattgaaccaaaa
ccttgcgaaccatctaaacatcaatatgattacgatgcggaaacagttatcggattttta
agacaatacgatttattgaatgatttcaaattaaatctggaagttaaccatgctacacta
gccggacatactttccaacatgaattgcaagttgccgtagatgctggtttattggggtct
attgatgcaaacagaggtgactaccaaaacggatgggacaccgatcaattccctaacaac
atcaacgaactggttgaatctatgctgattatccttagcggtggtggtttacaaggcgga
ggtgtaaacttcgacgcaaaaatcaggagaaactctacagatccggaagatttattctac
gcacatgttggcggcatggatatcttcgctaaagcactgctggttgctgatgaaattctt
tcaaattctgactataataaaataagaactgagagatacgcttcgtttgattctggaaaa
ggaaaagagtttgaagaaggtaaattgagcttagaagatttaaaagcatatgcaattagt
aatggcgaacctaaaatgagaagcggtaagcaagaatttttagaaaacgttattaataat
tatattttttga

DBGET integrated database retrieval system