KEGG   Pedobacter saltans: Pedsa_3358Help
Entry
Pedsa_3358        CDS       T01430                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
psn  Pedobacter saltans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pedsa_3358
   00500 Starch and sucrose metabolism
    Pedsa_3358
Enzymes [BR:psn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Pedsa_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3997629..3998594
Genome map
AA seq 321 aa AA seqDB search
MYKIKTLGLLLVLICNVSQLFANNYDFIVDGQGEGDFKTVQEAINAVPDFRKNPTLIFIK
NGIYKEKLILPGSKKNVKLVGESAEHTVLTYDDYASKKNRFGEEMGTSGSSSFYIYGDGF
VAENITFQNSSGPVGQAVAVQIIGDQIYFKNCRFLGFQDTLYTFGRGSRQLFDKCYIEGT
TDFIFGSSTVFFRECEIFCKKGGSFITAASTPDTVKYGYVFKDCKITGEEGASYYLGRPW
RPYAKTVFINCELGKHIKPAGWDFWGKESNKQTAFYAEYKNKGEGFKPKERVNWSHQLSN
QEAKHYNISEVLGDWVAFAGK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaattaagacacttggactgttacttgtattaatttgtaatgtaagccaacta
tttgcaaacaactacgattttatagttgatgggcaaggggagggagactttaagaccgta
caggaagccattaatgcagtacccgattttcggaaaaacccaacccttatctttattaag
aacggcatatacaaagaaaagctaatattgcccggttctaaaaagaatgtgaagcttgta
ggcgaaagtgcagagcatacagtcctcacctatgacgattacgcatctaagaagaatagg
tttggagaagaaatgggaacatccggttcttcttccttttacatttacggcgatggtttt
gtcgcagaaaatattactttccaaaattcttcaggccctgtagggcaggcagtggccgta
caaattataggagaccagatttattttaaaaattgtaggtttctgggctttcaggatacg
ttatacacctttggtaggggaagcagacaattatttgataaatgttatatagaaggaaca
accgattttattttcggatcttctactgtattttttagggaatgtgaaatattttgtaaa
aaaggaggttcgtttatcactgccgcatccactcccgataccgtaaaatacggttatgta
tttaaagattgcaaaattacaggggaagaaggggcatcctactatttgggaagaccctgg
agaccttacgcaaaaacggtttttatcaattgcgaattaggaaaacatataaagcctgct
ggttgggatttctggggaaaagagtctaacaaacaaactgctttttacgcagaatataaa
aataagggcgagggattcaaacctaaagaaagagtaaattggtcgcatcagttaagtaac
caagaagcaaagcattataatatatctgaagttttgggagattgggttgcttttgctggg
aaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system