KEGG   Pedobacter saltans: Pedsa_3366Help
Entry
Pedsa_3366        CDS       T01430                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
psn  Pedobacter saltans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pedsa_3366
   00500 Starch and sucrose metabolism
    Pedsa_3366
Enzymes [BR:psn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Pedsa_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4009277..4010278
Genome map
AA seq 333 aa AA seqDB search
MKIKSAILFLFLICGLIEGVKAQTSDNRFELVVAQDGSGDFKTIQEAVNKVRDHAEKRVT
ILIKPGIYKEKVVIPSFKRNVTLKGEDKDRTIITYDDFSGKPFRGIDVTGDSKFSTYTSY
TVLIAANDCSLENLTIENSSGRVGQAVALHTEGDRLAIKNCKILGNQDTLYLAKAGTRVY
FENCFINGTTDFIFGAATAYFSNCTIESLTNSYITAASTVKEDRYGFVFVDCKLIAKDAS
VTKVFLGRPWRPYAQTVFINTEMGKHIVKEGWHPWPGDKQFPDKEKTAYYAEYGSYGEGA
KDLSQRVAWSHQLKKSAIKKYSIEKVLNGWNPR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagtcagctattttatttctttttttgatctgtggtctgattgagggggta
aaagctcaaacttctgataatagatttgaattggttgtggcacaagacggttcgggcgat
tttaagaccattcaggaagcggtaaataaagtacgggatcatgcggagaaaagggttact
attttaattaagcccggtatttataaagaaaaggttgttattccttcttttaaaagaaat
gtgactttgaagggtgaagataaggatcggactatcattacctatgatgatttttcgggt
aagccatttaggggaatagatgttacaggagattctaaatttagtacctatacttcgtat
acggtgttaattgctgcgaatgattgcagtttggagaatttgactatcgaaaattcttcg
ggcagagttggccaggcagtagccttgcatacggagggagatagactagcgattaaaaac
tgcaaaattttaggcaatcaggacactttatatctggcgaaagcaggtacgagggtttac
tttgaaaattgcttcattaatggaacaacggacttcatctttggtgctgcgacggcttat
ttttccaattgtactattgagagtttaacgaattcttacattacagctgcttctacggtt
aaagaagatcgatatggttttgtgtttgtagactgtaaattgatagctaaagacgcatcg
gttactaaggtgtttttaggccgcccgtggagaccatatgcgcaaacagtatttatcaat
acagagatgggtaaacatattgttaaagagggatggcacccttggccaggagataaacaa
tttcctgataaggaaaagactgcttattacgccgaatacggtagttatggcgagggggca
aaagatctttcgcaaagggtagcctggtctcatcagcttaagaaatcagcaattaaaaaa
tacagtatagagaaagttttaaacgggtggaacccaagatag

DBGET integrated database retrieval system