KEGG   Pedobacter saltans: Pedsa_3401Help
Entry
Pedsa_3401        CDS       T01430                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psn  Pedobacter saltans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pedsa_3401
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pedsa_3401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pedsa_3401
Enzymes [BR:psn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pedsa_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047239..4048546
Genome map
AA seq 435 aa AA seqDB search
MKLYSTKNHNLSVDFETAVFNSLPADKGLYMPTFLPQLDAEIIANWDKKSLQEIAFDLAY
ELLKDDISAEDLKAIIDEAANFEAPLVPLDKDVFVLELFHGPSLAFKDFGARFMSRIMAH
FLKQEQKEIRILVATSGDTGGAVALGFLNVPGIKVTILYPKGKVSLIQELQLTTNGNNIE
ALEVDGTFDDCQALVKQAFLDRELNEKYNLTSANSINISRLIPQMFYYANSYARLKNEFK
DVTFVTPSGNFGNIAAGMIAHKMGMPVKRFIAATNSNDIVPQYLVTGVYTARPSVQTLAN
AMDVGDPSNFVRILDLYGNDKVELEKEFSSIAFDDLQIKQAIVKVYQEKGYIMCPHTATA
YLAIEADKAAGNQTEGNAYVMLSTAHPCKFPDVFEELNIQYEIPSSVDELYHKERQQKPM
TKRFEDFKAYLLGEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacagtaccaaaaaccataacttatcagtagattttgaaacagcggttttc
aatagcttgccagcggataaaggtttatatatgcctacttttttacctcagttagatgca
gaaattatagctaattgggataagaaatcattgcaggaaattgcgtttgatttagcttac
gaattattaaaagatgatatttctgctgaagatctgaaagcaataatagatgaagctgca
aatttcgaagctccattagttcctttggataaagatgtttttgtgctggaattgttccat
ggcccgtctttagcttttaaagattttggagcaagatttatgagccggattatggctcat
ttcctgaaacaggaacaaaaggaaattcgtattctggttgctacttccggagatacagga
ggtgctgttgctttgggcttcctgaatgttccgggaattaaagtgactatcctttatcct
aaggggaaagtaagtttgatccaggagttgcagttaactaccaacggaaataatattgaa
gcactggaagtagatggaacttttgatgattgtcaggctctggttaaacaagcctttctt
gatagagaactgaacgaaaaatacaatctgacttctgcaaactcgattaatatcagcaga
ttaattccgcagatgttttattacgcaaacagctatgctcgtttaaaaaatgagtttaaa
gacgtaacctttgttacgcctagcggaaactttggtaacattgctgccggaatgattgct
cataaaatgggaatgcctgtaaagcgttttatcgcagctacaaacagcaacgatatcgtt
cctcagtatttagtaacaggcgtttatactgcccgcccgagtgttcagacattagcaaat
gcaatggacgtaggcgatccgagtaactttgtacgtatccttgatttgtatggaaacgat
aaagttgaactggaaaaagagttttcatctatagcttttgatgatttgcaaataaagcag
gctatcgttaaagtatatcaggaaaagggttacatcatgtgtcctcatacagccactgct
tatttagctatagaggctgataaagctgccggcaatcaaactgagggtaatgcgtacgtg
atgctgtctacagcgcatccttgtaaatttcctgatgtttttgaggaattgaatatccag
tacgaaataccttcttctgtagatgaattataccataaagaacgtcagcagaaaccaatg
actaagagattcgaagattttaaagcttatttgttgggagaggtttga

DBGET integrated database retrieval system