KEGG   Pseudopedobacter saltans: Pedsa_3401Help
Entry
Pedsa_3401        CDS       T01430                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00260  Glycine, serine and threonine metabolism
psn00750  Vitamin B6 metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01230  Biosynthesis of amino acids
Module
psn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pedsa_3401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pedsa_3401
Enzymes [BR:psn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pedsa_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADY53935
UniProt: F0SDF2
Position
4047239..4048546
Genome map
AA seq 435 aa AA seqDB search
MKLYSTKNHNLSVDFETAVFNSLPADKGLYMPTFLPQLDAEIIANWDKKSLQEIAFDLAY
ELLKDDISAEDLKAIIDEAANFEAPLVPLDKDVFVLELFHGPSLAFKDFGARFMSRIMAH
FLKQEQKEIRILVATSGDTGGAVALGFLNVPGIKVTILYPKGKVSLIQELQLTTNGNNIE
ALEVDGTFDDCQALVKQAFLDRELNEKYNLTSANSINISRLIPQMFYYANSYARLKNEFK
DVTFVTPSGNFGNIAAGMIAHKMGMPVKRFIAATNSNDIVPQYLVTGVYTARPSVQTLAN
AMDVGDPSNFVRILDLYGNDKVELEKEFSSIAFDDLQIKQAIVKVYQEKGYIMCPHTATA
YLAIEADKAAGNQTEGNAYVMLSTAHPCKFPDVFEELNIQYEIPSSVDELYHKERQQKPM
TKRFEDFKAYLLGEV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacagtaccaaaaaccataacttatcagtagattttgaaacagcggttttc
aatagcttgccagcggataaaggtttatatatgcctacttttttacctcagttagatgca
gaaattatagctaattgggataagaaatcattgcaggaaattgcgtttgatttagcttac
gaattattaaaagatgatatttctgctgaagatctgaaagcaataatagatgaagctgca
aatttcgaagctccattagttcctttggataaagatgtttttgtgctggaattgttccat
ggcccgtctttagcttttaaagattttggagcaagatttatgagccggattatggctcat
ttcctgaaacaggaacaaaaggaaattcgtattctggttgctacttccggagatacagga
ggtgctgttgctttgggcttcctgaatgttccgggaattaaagtgactatcctttatcct
aaggggaaagtaagtttgatccaggagttgcagttaactaccaacggaaataatattgaa
gcactggaagtagatggaacttttgatgattgtcaggctctggttaaacaagcctttctt
gatagagaactgaacgaaaaatacaatctgacttctgcaaactcgattaatatcagcaga
ttaattccgcagatgttttattacgcaaacagctatgctcgtttaaaaaatgagtttaaa
gacgtaacctttgttacgcctagcggaaactttggtaacattgctgccggaatgattgct
cataaaatgggaatgcctgtaaagcgttttatcgcagctacaaacagcaacgatatcgtt
cctcagtatttagtaacaggcgtttatactgcccgcccgagtgttcagacattagcaaat
gcaatggacgtaggcgatccgagtaactttgtacgtatccttgatttgtatggaaacgat
aaagttgaactggaaaaagagttttcatctatagcttttgatgatttgcaaataaagcag
gctatcgttaaagtatatcaggaaaagggttacatcatgtgtcctcatacagccactgct
tatttagctatagaggctgataaagctgccggcaatcaaactgagggtaatgcgtacgtg
atgctgtctacagcgcatccttgtaaatttcctgatgtttttgaggaattgaatatccag
tacgaaataccttcttctgtagatgaattataccataaagaacgtcagcagaaaccaatg
actaagagattcgaagattttaaagcttatttgttgggagaggtttga

DBGET integrated database retrieval system