KEGG   Pseudopedobacter saltans: Pedsa_3431Help
Entry
Pedsa_3431        CDS       T01430                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00052  Galactose metabolism
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
Module
psn_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3431
   00052 Galactose metabolism
    Pedsa_3431
Enzymes [BR:psn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Pedsa_3431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADY53965
UniProt: F0SDI2
Position
4099222..4100280
Genome map
AA seq 352 aa AA seqDB search
MKNLNSLRHSFVPLQDKESSQFIVLENSQNTQIGISDFGARITHFLLPTSKEAIDIVLGF
DKLEDYLSAREKYHGVTVGPYANRIANGKFSLNNNEYTLAQNNGTNCLHGGIAGFHNRYW
DVEEFTKNSVTLSTTTEKGEEGFPGELSVKVKYTLGDDNALTIEYFAETAHDTVINLTNH
AYFNLNGAEQNDITAHVIIINSSEYAIVDERCIPTGELQNVENTPFDFRQPKVIAKDIEE
KDEQLIIGNGYDHSFQLKSEDNADLIFAAAAEGDISKIRLEVYTTEPAIQFYTGNYLGSG
DVGKEKTVYKDRSGFCFETQHHPDSPNRPEFPSTVLKAGDKFYSKTIYKALV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatttaaatagcctaagacattcttttgttccattacaggataaagaatcttct
cagtttattgtgctggaaaacagtcaaaacacacagataggaattagtgattttggtgcc
agaattacacattttttattacctaccagtaaagaagcgatagatatagttcttggtttt
gataaattagaggattacttaagcgcaagggaaaaatatcatggcgtaaccgtgggacct
tacgccaatagaattgccaacggaaaattctctttaaataataatgaatatacacttgcc
caaaacaatggaaccaattgtttacatggcggaatagcaggttttcacaatcgttattgg
gatgtggaggaatttaccaaaaattccgttactttatctacaacaacagaaaaaggggag
gagggctttccgggcgaactttctgtaaaagtgaaatatactttaggtgatgataatgcg
ctaacgattgaatactttgctgaaacagcacatgatacggttataaacttaacaaatcat
gcgtattttaatttgaatggtgctgaacaaaatgacattaccgcacatgttatcatcata
aactcatctgaatacgcgattgttgatgaaagatgtatacctaccggagaattacaaaat
gtagagaatacaccttttgattttagacagccaaaagtaattgctaaagatatagaagaa
aaagacgagcagctgattattggaaatggctacgatcattctttccaattgaaatcggaa
gataacgctgatttaatttttgcagctgcggcagaaggggatatctcgaaaattcgactg
gaagtctatacaacagaacccgctatacagttttatactggaaactacttaggaagtgga
gatgtaggtaaagagaaaacggtttataaggacagaagcggattttgttttgaaacccag
caccatcctgattcgccaaatcgtcctgaatttccgtctacagttttaaaagccggagat
aagttttattcgaaaactatctacaaagctctggtttag

DBGET integrated database retrieval system