KEGG   Pseudopedobacter saltans: Pedsa_3542Help
Entry
Pedsa_3542        CDS       T01430                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psn  Pseudopedobacter saltans
Pathway
psn00010  Glycolysis / Gluconeogenesis
psn00052  Galactose metabolism
psn00500  Starch and sucrose metabolism
psn00520  Amino sugar and nucleotide sugar metabolism
psn00521  Streptomycin biosynthesis
psn01100  Metabolic pathways
psn01110  Biosynthesis of secondary metabolites
psn01120  Microbial metabolism in diverse environments
psn01130  Biosynthesis of antibiotics
psn01200  Carbon metabolism
Module
psn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3542
   00052 Galactose metabolism
    Pedsa_3542
   00500 Starch and sucrose metabolism
    Pedsa_3542
   00520 Amino sugar and nucleotide sugar metabolism
    Pedsa_3542
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pedsa_3542
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pedsa_3542
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pedsa_3542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF1296
Motif
Other DBs
NCBI-ProteinID: ADY54072
UniProt: F0SF04
Position
4217755..4218633
Genome map
AA seq 292 aa AA seqDB search
MNNIVAGVDIGGSHITVALVNLDTLEIIDKSLIRERVDSAAVAEEIIIAWCSAIAKSFNT
CPQSEKKLGIAMPGPFDYENGISYIKDLHKYDSLYGLNVKELIAYHLDIPKENIRLNNDA
ACFLQGEIYKGSLEGCSVAVGLTLGTGLGSAYMKSGESFDANLWCTPYKGDIIEECISSR
WFVRQFQQRAGKSVKDVKEIVEKYPDHEITKELFEEFSDNLASFLAYFIQKEQGEVVVLG
GNISKAKDFFIDNIKQKLYESVGKVIPIYLSVLGERAALIGGAAQFHTLKQL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagtagcgggagtagatatcggaggctcccacattaccgtggccctggtg
aatttggatactttggagataattgataaaagtcttatcagagaaagggttgactcggct
gctgttgcggaagaaattattatagcatggtgtagtgcaatagctaaatcgtttaatacc
tgcccacagagcgaaaaaaaattaggtatagcaatgccgggtccgttcgactatgaaaat
ggcataagctatatcaaagacctgcacaaatatgattcactgtacggtcttaatgtaaag
gagttgattgcctaccatctggatatcccaaaagaaaatattcggttaaacaatgatgct
gcttgttttcttcagggcgaaatatataaaggtagtcttgaaggttgttcagtagcggtt
ggactaaccctaggtacgggtttgggatcggcctatatgaaatctggggagtctttcgat
gctaatctgtggtgtaccccgtataaaggagatattattgaagaatgtatatcctcccgc
tggtttgtcagacaattccagcaaagggcaggtaaatctgtaaaagacgtaaaggaaatt
gtagagaaataccctgatcatgagattacgaaggaactgtttgaagagtttagtgacaat
cttgcttcatttttagcatattttattcaaaaagaacagggagaggtagtggttcttggc
gggaatatttcgaaagccaaagatttctttattgataatataaaacaaaaactatatgaa
tcggttgggaaagttattcctatttacctttctgttcttggagaaagagccgctttaata
ggaggagccgcacagttccataccttaaagcaattataa

DBGET integrated database retrieval system