KEGG   Pedobacter saltans: Pedsa_3616Help
Entry
Pedsa_3616        CDS       T01430                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
psn  Pedobacter saltans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:psn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:psn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:psn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4311285..4312835
Genome map
AA seq 516 aa AA seqDB search
MKKTYLSILILGFLGISNSTYVKAQQSVNSEAILTPKHGPEPKINGAKVFGVRPGHPIIY
TIPTSGLRPMKFSVKGLPKGVSLDENTGRLSGVISKAGTYNMSINAQNAHGKTNRDFTII
VGETIALTPPMGWNHYNIYGTRITQEQVLLQAKAMVSTGLINHGWSYMNIDDGWQGARGG
KHFAILPDSTRFPDMQGLVNQVHDLGLKIGTYSTPWVESYGHRIGGSAMNAEGKFERTKE
NIARNKKILPYAIGDYHFWKNDAKQFAEWGFDYLKYDWNPIELKETKEMYDALRDSGRDI
VYSLSNSTPFATIKELSEVSNTWRTGGDIKDNWKSLKSRIFTQDKWAPFARPGHWNDPDM
MIVGVVGWNSAEKWPSKLTPDEQYTHMSAWCLMSVPLLLGCDISKMDDFTLNLLTNDEVI
AVNQDPLGKQATVIKREGDKGVMAKDLADGTKAVGLFNLEDNGEQTIALKWSDLGIKGKY
MVRDLWRQKDLGIYENEFKANVAEHGVVMISVRRVK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacttatttatcaatattgatattagggtttcttggaataagtaactcaact
tatgtaaaggcccagcagtctgtaaattcagaagctattttgactcctaaacatggccct
gaaccaaaaattaatggtgctaaagtttttggagtacgcccgggacatccaataatatac
actataccaacctctggtctcaggccgatgaaattctcagttaaaggccttccaaaagga
gtaagtttggatgaaaataccggaagattgtcgggtgtaatatcaaaggccggaacttac
aatatgtccataaatgctcaaaatgctcatgggaagacaaaccgggattttacgattata
gttggtgaaacgatagcattaactcctccaatggggtggaaccattataatatatatgga
accaggattacgcaggagcaagtgttattgcaagcgaaagctatggtttcaaccggatta
attaaccatggctggtcttatatgaatatagatgatggttggcagggagcaagaggaggt
aaacattttgctattttaccagatagtactcgttttccagatatgcagggtttggtaaat
caagtgcatgatctcggattgaaaattggtacatattcaactccctgggttgagtcatac
ggacatagaataggaggttccgctatgaacgccgagggaaaatttgaaagaacaaaagaa
aatatagccaggaataagaagattttaccttatgcaataggcgattatcatttttggaag
aatgacgcaaaacaatttgccgaatggggatttgattacctgaaatacgattggaacccg
atagagttaaaggaaaccaaggaaatgtatgacgccttgagagatagcgggagagatatt
gtttatagcttatcgaatagtacgccttttgcgacaataaaggagctttcggaggtttcg
aacacatggagaacaggaggagatataaaagacaattggaaaagcttaaaaagcagaatc
tttacacaggataaatgggcaccattcgccagacctggacattggaatgatccggatatg
atgattgtaggtgttgttggatggaattctgccgaaaaatggccttccaagttaactcct
gatgaacaatatacgcatatgagtgcatggtgtctcatgtctgttccattgttattaggt
tgtgatatttctaaaatggacgattttacattgaaccttcttactaacgatgaagtcatc
gctgtgaatcaggatcctctgggaaaacaagcaaccgtgataaaaagagagggagataaa
ggagtaatggctaaagatttggcagacggtactaaagcagttggcttatttaatttggaa
gataatggagagcaaacaattgcattaaagtggtcagatttaggtattaaaggtaagtat
atggtgcgggatttatggagacagaaggatctgggcatttatgaaaacgagtttaaagca
aatgtagcagagcatggtgtggtcatgatctcggtgcgtagggtaaaataa

DBGET integrated database retrieval system