KEGG   Pedobacter saltans: Pedsa_3756Help
Entry
Pedsa_3756        CDS       T01430                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psn  Pedobacter saltans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pedsa_3756
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pedsa_3756
   00052 Galactose metabolism
    Pedsa_3756
   00500 Starch and sucrose metabolism
    Pedsa_3756
   00520 Amino sugar and nucleotide sugar metabolism
    Pedsa_3756
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pedsa_3756
   00524 Butirosin and neomycin biosynthesis
    Pedsa_3756
Enzymes [BR:psn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pedsa_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4516482..4517366
Genome map
AA seq 294 aa AA seqDB search
MDNKNIVVGVDVGGSHITAALVDINSRSLIEGTTVRKAVDSKGSAAEILSVWKAVIKDTS
MIGGCSIKRIAFAMPGPFNYENGISLIKGVDKYESLYGMNIKKELADCFNIQDDQILFRN
DAEAFLHGEVAVGDFDITDKILGFTLGTGFGSAYSYQGDTRDLGIGLLPFKETIADDYLT
TRWFRNMYGTKTGQFNNVQQISQLAQEGDDTALQLFNEFADNLAEVLGKQIKEIDAVHII
LGGNISKAQEFFLPRTQYQLNQEGIFPQFYLAKLGEQSAIVGSAYLFAPLFDVI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggataacaagaatattgttgtaggggttgatgttggcgggtcgcatatcaccgcggca
ttagttgatattaacagcagaagtttgattgagggaactacagttagaaaagcggtagat
agtaaagggagtgcagctgaaattttatcggtatggaaagccgtaattaaagatacctct
atgattggaggatgtagtataaagcgaatagcttttgcgatgccggggccttttaattac
gagaatggaataagtttgatcaaaggggtagataaatatgaaagtttgtatggaatgaat
atcaaaaaggaacttgccgactgttttaatattcaggacgaccagattttatttcgtaat
gatgctgaagcatttttacatggagaagtagctgttggagattttgatatcacagataag
attttaggctttactttaggaaccggatttggatctgcttatagttaccagggagatacc
agagatttgggtattggtctcttgcctttcaaagagactattgccgatgattatttgacc
acaaggtggtttcgtaatatgtatggaacaaaaacggggcaatttaacaatgtgcagcaa
atcagccagctggctcaggaaggtgatgacacagccttacagctatttaatgaatttgct
gataatttagcggaggtgcttggcaaacagataaaagaaattgacgctgttcatattatt
cttggggggaatatttctaaggcacaggaattctttttgccgcgtacccagtatcaactg
aatcaagaaggtatatttcctcagttttatttagccaaactaggcgaacaatcagctatt
gtgggtagtgcctatttgtttgccccactatttgatgtgatatag

DBGET integrated database retrieval system