KEGG   Psychrobacter sp. G: PSYCG_04580Help
Entry
PSYCG_04580       CDS       T02715                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pso  Psychrobacter sp. G
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pso00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSYCG_04580
   00650 Butanoate metabolism
    PSYCG_04580
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSYCG_04580
   00280 Valine, leucine and isoleucine degradation
    PSYCG_04580
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSYCG_04580
Enzymes [BR:pso01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSYCG_04580
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     PSYCG_04580
Amino acid related enzymes [BR:pso01007]
 Aminotransferase (transaminase)
  Class III
   PSYCG_04580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000261..1001520
Genome map
AA seq 419 aa AA seqDB search
MTTNQSLLARRKAVLPTGLGVAFPIFAEKAKNSEVWDIEGNRYIDFVGGISVLNTGHSHP
KITQRVHEQLDKFTHTAAQMINYECYVDLAEKLCEKAPISGDTKAFFLTTGAEAVENCIK
IARAKTRRPGVISFVGGWHGRTLMCMSLTGKVLPYKKNFGPMPGPVFHALFPCDELNVTE
EQALHSLEMIFQADIDPSEVAAMIIEPVQGEGGFHQVTPSFAKSLRDICDEHGIVLIFDE
VQCGFARTGTLFACEQLGVEPDLMTSAKSLAGGYPISAVIGRADIMDAPQVGGLGGTYAG
NPLACVAALAVIEVIEEENLLERSIEIGDKIESFLKGLNLSSIGHIRHKGAMLAFELIDS
EGKPDVEATTNLKAKSFEQGLLLASCGMHGNAIRVMVPLTVEDEVLQEGLDIIKGILTA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaatcaatcattacttgcacgccgtaaagcggtattgccaaccggactgggt
gtggcttttcctatctttgccgaaaaagcaaaaaactcagaagtttgggatattgaaggc
aatcgttatatcgatttcgttggcggcatctcagtactaaataccggtcacagtcatcca
aaaatcacgcagcgtgtgcacgagcagctagacaaattcacccatactgctgcgcaaatg
attaactatgaatgctatgtcgatcttgccgaaaaactttgcgaaaaagcgcctatcagt
ggcgatacaaaggcattcttcttgaccactggtgcagaagcggttgaaaactgtatcaaa
attgctcgtgcaaaaacccgtcgtccaggcgtgatttctttcgttggcggttggcatggc
cgcacgcttatgtgcatgagcttgactggtaaagtattgccatacaaaaagaactttggt
ccgatgccagggcctgtattccatgcactattcccatgcgatgagctgaatgttactgaa
gaacaagcattgcatagccttgagatgattttccaagcggatatcgatcctagtgaagtg
gcggcgatgattatcgagccagtacaaggtgagggtggcttccatcaagtcacgccatca
tttgctaagtctttacgcgatatctgtgatgagcacggcattgtcctaatctttgatgaa
gtacagtgtggttttgcgcgtacgggtacgttgtttgcctgtgaacaattgggcgttgag
ccagatctaatgaccagtgctaagagcttggcaggtggttatcctatttctgccgttatt
ggtcgtgccgatattatggatgccccgcaagtaggtggcttgggtggtacttatgctggc
aacccacttgcttgtgtagccgctttagcagtcatcgaagtcatcgaagaggaaaaccta
cttgagcgtagtattgaaattggcgacaaaattgagtcatttttaaaaggcttaaactta
agtagtatcggacatattcgccataaaggcgccatgctcgcgtttgaattaatcgatagc
gaaggtaagccagacgttgaagcgacgactaacctaaaagcgaaatcatttgagcaaggt
ttgttactagcatcttgcggtatgcatggcaatgccattcgtgtgatggtgccattgacg
gttgaagatgaagtgctacaagaaggtcttgatatcatcaaaggtattttgactgcctaa

DBGET integrated database retrieval system