KEGG   Psychrobacter sp. G: PSYCG_06990Help
Entry
PSYCG_06990       CDS       T02715                                 

Definition
(GenBank) hypothetical protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
pso  Psychrobacter sp. G
Pathway
pso00220  Arginine biosynthesis
pso00250  Alanine, aspartate and glutamate metabolism
pso00471  D-Glutamine and D-glutamate metabolism
pso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pso00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSYCG_06990
   00220 Arginine biosynthesis
    PSYCG_06990
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PSYCG_06990
Enzymes [BR:pso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PSYCG_06990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase RuBisCO_large_N BON
Motif
Other DBs
NCBI-ProteinID: AGP48918
UniProt: T1EBK8
Position
complement(1610004..1610291)
Genome map
AA seq 95 aa AA seqDB search
MQQILNDIAAEMALETDRGKVADYIPQLAHVDPNQFGIAVATSDGQVYVAGDASTLFSIQ
SISKVFTLTIGLGKLGDAIWTHVGREPSGDPLTLF
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagattcttaatgatattgccgcagagatggcccttgaaaccgatcgtggaaaa
gtggcagattatatcccgcaactggcgcatgtcgatccgaaccagtttggtattgccgta
gcgacatctgatgggcaggtatatgtagcaggggatgcgagcaccctattctcgatccaa
agtatctccaaagtatttaccttaaccatcggtcttggcaagttaggtgatgcaatttgg
acccatgttggtcgtgagccatctggcgatcccttaacgcttttttaa

DBGET integrated database retrieval system