KEGG   Psychrobacter sp. G: PSYCG_08490Help
Entry
PSYCG_08490       CDS       T02715                                 

Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
pso  Psychrobacter sp. G
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pso00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSYCG_08490
Enzymes [BR:pso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PSYCG_08490
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PSYCG_08490
Glycosyltransferases [BR:pso01003]
 Polysaccharide
  Bacterial polysaccharide
   PSYCG_08490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968536..1971019
Genome map
AA seq 827 aa AA seqDB search
MQKSNSKQPQSSKPAINTLPSQQRGVVFSSILLIVVIAGMVLLALYLVKLDRTITHKFEG
KRWDIPAKVYSQPLELYQGANVDKDTMKKWLELLNYQSNKAYDRTGTYHKSGNTYFIHTR
GFTYSANDIDQEQVIKMTIAGDKIESVQSTVAAKTGIIRLEPVNIGGIYPDSNEDRMVVS
LDQVPQPLIDALIATEDRGFYEHKGVSIRGIARAVINNFSGGSRQGGSTITQQLIKNFYL
NSDRTMKRKANEALMAVLLELHYSKDEILQAYLNEIYLGQNGKRSINGFGLASQFYFDKP
LNELRLDQQALLVGMAKGPSVYNPRRHPNDSKARRDVVLSNMLAVGSLSQEDYDKALKNS
LGVVDKPVEGKSQFPDFLDIVKRELNKVYYSDDLKNEGLIIISTMDPIAQLAADKAVERK
LGELRRSGSKTKDLQGALVSANPETGELVSVVGSGSEFTGFNRAVDAKRQVGSLLKPIIY
MTALESGRYNLASSVDDSPITVSLSDGTEWNPKNYDNRDHGYIPFTTALSQSYNHSAVRL
GMEFGVDTFAKQLKRMGVKEKIPPYPAALLGSVNLSPMDMLGVYQVFATGGFRTPIHSIR
SVIDDRGSILQRTGLNTQRSIPPETNFLINYALQDVVKNGTARRVQSLGSNLNLAGKTGT
TNDYRDAWFAGYSGNYVSVVWVGRDDNKPIGLSGGSGALPVWVDYMNRLKLTPVALPEPE
GIEWLWLENNSGKLSNERCASARYLPVMSAYLPQEASSCAIGLYQQDRAREQMQWQNQQG
NINKQRRREGLEIPDGEAIDNNSSDAEQDGDIPNRVDTWYDRAVEWF
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaatctaattctaagcaaccacagtcctctaagcctgctatcaatacgctacct
tcccagcagcgcggtgtggtgtttagtagtattttattaattgttgtcatcgctggcatg
gtgctattagcactatacttggtcaaacttgatcgcaccattactcacaagtttgagggt
aaacgctgggatattcctgccaaagtatattcgcagccattagagctgtatcaaggcgcc
aacgtcgataaagacacgatgaagaaatggcttgagctacttaactatcaaagtaataaa
gcctatgatcgcacgggtacttatcataaatcaggtaatacctattttattcatacacgt
ggatttacttatagcgctaatgatatagaccaagagcaagtcatcaaaatgactattgct
ggtgataagattgagtcagtacaaagtactgtggcggcgaaaaccggcattatccgtctt
gaaccggtgaatatcggtggtatttacccagatagtaatgaagaccgtatggttgtctcg
ttagatcaagtaccgcagccgcttattgatgcgctgatagcgacagaagatcgtggtttt
tatgaacacaaaggggtatcgatacgtggtatcgctcgtgcagttatcaataacttctct
ggtggatcacgtcaaggtggctcgaccatcacccagcagctgatcaaaaacttttatctc
aattcagaccgcacaatgaagcgtaaagccaatgaagccttgatggctgtgctacttgaa
ctgcattatagtaaagatgagattttgcaagcatatctcaatgagatttatcttggtcaa
aatggcaaacgctctattaatggttttgggttggcatcacaattttattttgataagccg
ctcaatgagctgcgcctagatcagcaagcactgcttgtcggtatggcaaaaggaccgagc
gtttataatccgcgccgccatccaaacgattcaaaggcgcgtcgcgatgttgtgcttagc
aatatgttggcggtcggctcgctcagtcaagaagactacgataaagcattaaaaaactca
cttggggtagttgataagcctgttgaaggtaaaagccaattccctgactttttagatatc
gtcaagcgtgaactaaataaagtctattattccgatgatctcaaaaacgaaggtctgatt
atcatcagtacgatggaccctattgcccagttggcagcggataaagcggttgagagaaag
cttggcgagctacgccgtagtggtagcaaaaccaaagatttacaaggggcgctggtcagt
gccaatcctgagacgggtgagctggtttctgttgtcggtagcggcagcgagtttactggc
tttaaccgtgcggtcgatgccaaacgccaagtaggctcattattaaagccgattatttat
atgactgctctcgaaagtggtcgctataatttggcaagttcggttgatgactcccctatt
acggtcagtctaagcgacggtaccgaatggaatcccaaaaactatgacaatcgtgatcat
ggctacataccctttaccacagcgctgtcgcaatcgtataaccatagtgccgtacgctta
gggatggagtttggagtcgacacctttgccaagcaattaaaacgtatgggcgttaaagag
aaaatacctccttatcctgcggcattattgggctcagtcaatctaagcccgatggacatg
cttggggtctatcaagtttttgcaacgggtggtttccgtacgcctattcatagtatccgt
agtgtgattgatgatcgcggtagtattttgcagcgcacaggcttaaatactcagcgcagt
attccgcctgagaccaactttttgattaattatgcgttgcaagatgtcgtcaagaacggt
acagctagacgcgtgcaatcgcttggtagcaatctaaatcttgcgggcaaaacaggtact
accaatgattaccgcgatgcgtggtttgccggttatagtggcaactatgtcagcgtggtt
tgggttggacgtgatgataataaaccgattgggcttagtggcggtagcggtgctttgcca
gtttgggttgattatatgaatcgtctaaaactgacacctgttgcgctaccagagccagaa
ggcatcgaatggctctggttagagaacaactcaggcaagctgtctaatgagcgctgtgcc
agcgcacgctacttgcctgttatgtcagcatatttgccccaagaagccagcagctgtgcg
attggcttataccaacaggatcgtgcgcgcgagcaaatgcagtggcaaaatcagcaaggc
aatatcaataagcaacgtcgccgtgaaggattagagattccagatggtgaggctattgat
aataacagcagtgatgccgagcaagacggtgatatacccaatcgtgtagatacttggtat
gatcgtgctgttgaatggttttag

DBGET integrated database retrieval system