KEGG   Psychrobacter sp. G: PSYCG_09695Help
Entry
PSYCG_09695       CDS       T02715                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pso  Psychrobacter sp. G
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSYCG_09695
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSYCG_09695
  Energy metabolism
   00680 Methane metabolism
    PSYCG_09695
Enzymes [BR:pso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSYCG_09695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247804..2250584
Genome map
AA seq 926 aa AA seqDB search
MIIDNDILRERISLLGSFLGDAISRQTGEQTLHTIETLRKGFIQQRREPNEAHKQKLIDF
IASLDNQALKNVIRSFSIYFFLANLSEENYLREERHALRMQSEQSWEGSFRRTLLECRER
NIEPAQMQELIEQLKFIPVFTAHPTEARRRTTMNLLQGLFTHSDALNNVAQNSFAYEQAR
EKTAQSIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKNAIIDIYPEL
TDYPLPAFISFGSWIGGDRDGNPFVTHDTTEMAVLMHADTVLRHYQVLLKKLRRQLIHSD
TIVTIEPDVYAKIESYSELDRRVFDYNLDDYGNEPYRRFLSLILNKVKATNLLIQSKGND
TEAKKDAYANPQELLEDLRIIRQSVNTHDTAHGEGLLLDIIRLVKTCGFHLAALDIRQES
SYHSEVIADIFANASNLPDYQSLNETERQEWLTRLLEKPGTPLIYTDNLTDKTREQLALM
HSVATLRKLVGQDTFGSYVISMTNNASQLLEVLLLMRFAGLCRVDDEGRLSADLPVAPLF
ETIEDLKNIDKILPEVLDNPLYRGLLQHSDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINRIAEEYGIKTRLFHGRGGSVSRGGGSTHKAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMGITGTLKACSSRFVVQPPELPHYEALFARLADAGEQRYRKLTDHTEGFY
QFYSQATPVAEISLLNIGSRPAHRNKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
HSVIDDEALMKEMIDCWPFFNVFISNIEMAFTKSDMSIAHAYSQLCDDEILREQIMTAVT
DEHELTHSGLNSLLNQESLLEHQQNLAASLEWRNAYLDPTNYIQIELLKRARQKDATSDT
NHGDLDVEDPLIRSINALAAGLRNTG
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgataatagataatgacatattacgtgaacgcattagtttattaggttccttcctaggg
gatgcgatttctcgccagactggtgaacaaacgctgcatacgattgaaacgctacgcaaa
ggttttattcaacagcgccgtgagcctaatgaagctcataagcagaagctcatcgatttt
attgcctctttggacaatcaagccttaaaaaatgtcatccgcagcttctctatctatttt
ttcttagccaatctaagtgaagagaattatctacgtgaagagcgccatgcattacgtatg
caatcagagcagagctgggaaggatcgtttcgccgtactttactagagtgtcgtgagcgc
aatattgagccagcacagatgcaagagctcattgagcaactaaaattcatccctgtattt
accgcccatcctactgaagcgcgtcgacgtacaacgatgaacttattacaaggtttattc
actcatagcgatgccttaaataacgttgcacaaaatagttttgcctacgagcaagccaga
gaaaaaactgcgcaatcgattgatctgctatggtcgtctgatgaagtgcggacgcgtaag
cctttggtctatgacgaaataaataatggtctgcattatttcaatgccagtctattcaac
gccattcccaaggtttatcgtaatattaaaaacgctattattgatatctatcctgagcta
acagactaccctctacctgctttcataagctttggctcttggattggtggcgacagagat
ggcaatccctttgtcactcatgacactacagaaatggccgtattgatgcatgcagatact
gtattgcgtcactatcaagtgttgctcaagaaactacgtcgtcagcttattcatagtgat
acgattgttactatcgaacctgatgtgtatgccaagattgaaagttatagtgagctcgac
agacgagtctttgattacaatcttgatgattacggcaatgaaccttatcgcagattcctc
tccttaatcctaaataaagtcaaagccaccaatcttctaatccaaagcaaagggaatgat
actgaggctaaaaaagatgcctacgccaatccacaagaactattagaagacttacgcatc
atccgtcaaagtgtgaatactcatgatactgcacatggcgaaggcttattactcgatata
atacgtttggtcaaaacctgtggcttccatttggcagcgctcgatattcgccaagagtcg
tcttatcatagcgaagtgattgccgatatttttgccaatgcttctaacttgcctgactat
caaagcctcaatgaaaccgagcgccaagaatggctaacgcgcctgcttgagaaaccaggc
acaccgctcatttataccgataatttaacggataaaacccgtgaacaattggccttgatg
cactcagtagcgactttacgcaaactggttgggcaagatacttttggcagttatgttatc
tccatgaccaataacgccagtcaattattagaagttttgctactcatgcgctttgcaggc
ttatgtagagtggatgacgaagggcgactgtctgccgacttgccagtagcaccgttattt
gagacgatagaagatcttaaaaacatcgataaaattctacctgaagttttagacaatcca
ttatatcgagggttgttgcagcattcagataatacccaagaaatcatgctgggctattcg
gactcttcaaaagacggaggcatcattacttctgcatggcagctttatagcgcacagcag
accattaaccgtatcgcagaagaatatggcatcaaaacccgcttatttcatggtcgcggt
ggctctgtgagtcgtggtggcggctcaacgcataaagcgattgctgctcagcccgctggt
acactgcatgggcaaattaaagtgaccgaacaaggcgaagtcctttatgccaaatatgcc
aacaccgataccgctgtatttgagctaaccatgggcatcactggcacgcttaaagcttgc
tcctcaagattcgtggtgcaaccgcctgaattgccacattatgaagcgctctttgcacgt
ttagcagacgccggtgagcaacgttatcgcaagctaacggatcataccgaagggttttat
cagttctactcccaagcgacgccagtggcagaaatctccttattaaatattggctcacgc
ccagcacatcgtaataaaggtctaccaagcaaaacaaccttgcgcgcaattccttgggta
tttggctggtcattagcgcgctttacactgcccgcttggtatggtgtcggcagtgcgttg
catagcgtcatcgatgatgaagcactgatgaaagaaatgattgactgctggccatttttt
aacgtgtttattagcaatattgaaatggcgtttaccaagtctgatatgagtattgctcat
gcttatagccaattatgtgacgatgagatattacgtgaacagattatgacagcggtgacg
gatgagcacgagctgacccattcaggtttaaactctttgcttaaccaagagtcgttattg
gagcatcagcagaatcttgccgcttcccttgaatggcgtaatgcgtatttagatccaacc
aactatatccaaattgagctattaaagcgtgccagacaaaaagacgctacaagcgatacc
aatcatggtgacctcgacgttgaagacccattaatccgtagtattaatgccttggcagca
ggtctacgcaatacagggtaa

DBGET integrated database retrieval system