KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0036Help
Entry
PSPPH_0036        CDS       T00266                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPPH_0036 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPPH_0036 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPPH_0036 (trpB)
Enzymes [BR:psp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSPPH_0036 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41351..42580)
Genome map
AA seq 409 aa AA seqDB search
MTQTNFRSGPDVNGLFGSFGGRYVAETLMPLVLDLNREYEAAKADPEFAKEMAYFQRDYV
GRPNPLYFAERLTEFCDGAKIYFKREELNHTGAHKINNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTSGTGTLKDAMNE
ALRDWVTNVDDTFYLIGTVAGPHPYPAMVRDFQAIIGKETKEQMQEKEGRLPDSLIACVG
GGSNAMGLFHPFLDDASVEIIGVEAGGHGVDTDKHAASLNGGVPGVLHGNRTYLLQDGDG
QITDAHSISAGLDYPGIGPEHAFLHEVKRVEYVSITDDEALDAFHQCCLLEGIIPALETA
HALAEAMKRATNLRDDHLMVVCLSGRGDKDMQTVMNHMAAAEKTQEKLV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccaacttccgcagcggccccgacgtcaacggcctgttcggctcattcggc
ggccgctacgtggctgaaactctgatgccgctggtgctagacctcaaccgcgagtacgaa
gccgccaaggccgacccggagttcgccaaggaaatggcctacttccagcgcgattacgtg
ggccgtccaaacccgctgtacttcgccgagcgcctgaccgaattctgtgacggcgcgaag
atctacttcaagcgcgaagagctgaaccacaccggcgcgcacaagatcaacaactgcatc
ggccaggtattgctggccaagcgcatgggcaaaaaacgcctgattgcggaaaccggcgcg
ggcatgcacggcgttgctaccgctaccgtcgcggcgcgctttggcttgccttgcgtgatc
tacatgggcgcgaccgacatcgaacgtcagcaggccaacgtgttccgcatgaagctgctg
ggcgccgaaatcgtgccggtcacttccggcaccggcaccctgaaagatgcgatgaacgaa
gccctgcgtgactgggtgaccaacgtcgacgacaccttttacctgatcggcactgtggca
ggtccgcatccgtatccggcgatggtgcgtgatttccaggccatcatcggcaaggaaacc
aaagagcagatgcaggagaaggaaggtcgtctgccggacagcctgatcgcctgcgtgggc
ggcggctccaacgccatgggcctgttccatccgttcctcgatgacgccagcgtagaaatc
atcggcgttgaagcgggcggtcacggcgtggataccgacaagcacgcggccagcctcaat
ggcggcgtaccgggcgtgctgcacggcaaccgtacctacctgctccaggatggcgacggg
cagatcacagacgcgcactcgatctctgctggcctggactatccgggtatcggcccggag
cacgccttcctgcacgaagtgaaacgcgtcgagtacgtcagcatcaccgatgacgaagcg
ctggatgccttccatcaatgctgcctgctcgaaggcatcatcccggcactggaaaccgct
catgcactggccgaagccatgaagcgggcaaccaacctgcgcgacgaccacctgatggtc
gtgtgcctgtccgggcgcggtgacaaagacatgcaaaccgtcatgaaccatatggcagcc
gccgaaaaaactcaggagaagctggtatga

DBGET integrated database retrieval system