KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0095Help
Entry
PSPPH_0095        CDS       T00266                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00250  Alanine, aspartate and glutamate metabolism
psp00310  Lysine degradation
psp00650  Butanoate metabolism
psp01100  Metabolic pathways
psp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSPPH_0095 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPPH_0095 (gabT1)
   00310 Lysine degradation
    PSPPH_0095 (gabT1)
Enzymes [BR:psp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSPPH_0095 (gabT1)
    2.6.1.48  5-aminovalerate transaminase
     PSPPH_0095 (gabT1)
Amino acid related enzymes [BR:psp01007]
 Aminotransferase (transaminase)
  Class III
   PSPPH_0095 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ36014
UniProt: Q48QA9
Position
complement(104710..105990)
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFIDFAGGIAVLNTGHLH
PKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINAKVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPCELHGVS
VDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAFMLRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPVACAAALAVLDIFEEEHLLDRCKAVGERLVTALKGIQAKYPVIGEVRALGAMIAVEL
FEDGDSHKPNAAAVVQVVAKARDKGLILLSCGTYGNVLRVLVPLTAEDELLTRGLAILEE
CFAEIA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgaatccctgatgcaacgccgccatgctgccgtcccgcgtggcgtt
ggtcagatccacccgatcttcgctgcttcggcgaagaacgcgaccgttaccgacgtggaa
ggtcgtgagttcatcgacttcgcgggcggtattgccgttctgaacaccggtcacctgcac
ccgaagatcattgccgctgtgcaagagcaacttaccaagctgagccatacctgcttccag
gtgctggcctacgagccttacgtcgagctgtgcgagaagatcaacgccaaagtgccgggt
gatttcgacaagaaaaccctgctggtgaccaccggttccgaagcggttgaaaacgccgtg
aagatcgcgcgtgctgccactggccgtgcgggcgtgatcgccttcaccggcgcttaccac
ggtcgcactatgatgaccctgggcctgaccggtaaggttgtgccttactcggcgggcatg
ggcctgatgccgggcggtatcttccgcgcgctgtacccttgcgagctgcatggtgtgagc
gttgacgattccatcgccagcatcgagcgcatcttcaagaacgacgccgaacccaaggac
atcgctgcgatcatcatcgagccggttcagggcgaaggtggtttctacgtggcaccgaag
gcgttcatgctgcgtctgcgcgagctgtgcgacaagcacggcattttgctgatcgctgac
gaagtgcagaccggcgctggccgtaccggcacgttcttcgcgatggagcagatgggcgtt
gcggccgacctgaccaccttcgccaagtccatcgccggtggcttcccgctggcgggcgtg
tgcggcaaggctgaatacatggatgccatcgcaccgggcggtctgggcggcacttatgct
ggtagcccggttgcttgcgctgcggcgctggcggtgctggatatcttcgaagaagagcac
ctgctggaccgttgcaaggcggtgggcgagcgtctggtgactgcgctcaagggcattcag
gccaagtacccggtcattggcgaagtgcgtgcgctgggcgcgatgattgccgtcgagctg
ttcgaagatggcgattcgcacaagcctaacgccgcagcagtggtgcaggtagttgccaag
gcgcgtgacaagggtctgatcctgctgtcctgcggtacttacggcaacgtgttgcgcgta
ctggtaccgttgaccgctgaagacgaattgctgacccgtgggctggccattctggaagaa
tgcttcgctgaaatcgcgtaa

DBGET integrated database retrieval system