KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0095Help
Entry
PSPPH_0095        CDS       T00266                                 

Gene name
gabT1
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSPPH_0095 (gabT1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSPPH_0095 (gabT1)
   00310 Lysine degradation
    PSPPH_0095 (gabT1)
Enzymes [BR:psp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSPPH_0095 (gabT1)
    2.6.1.48  5-aminovalerate transaminase
     PSPPH_0095 (gabT1)
Amino acid related enzymes [BR:psp01007]
 Aminotransferase (transaminase)
  Class III
   PSPPH_0095 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(104710..105990)
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRHAAVPRGVGQIHPIFAASAKNATVTDVEGREFIDFAGGIAVLNTGHLH
PKIIAAVQEQLTKLSHTCFQVLAYEPYVELCEKINAKVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPCELHGVS
VDDSIASIERIFKNDAEPKDIAAIIIEPVQGEGGFYVAPKAFMLRLRELCDKHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPVACAAALAVLDIFEEEHLLDRCKAVGERLVTALKGIQAKYPVIGEVRALGAMIAVEL
FEDGDSHKPNAAAVVQVVAKARDKGLILLSCGTYGNVLRVLVPLTAEDELLTRGLAILEE
CFAEIA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgaatccctgatgcaacgccgccatgctgccgtcccgcgtggcgtt
ggtcagatccacccgatcttcgctgcttcggcgaagaacgcgaccgttaccgacgtggaa
ggtcgtgagttcatcgacttcgcgggcggtattgccgttctgaacaccggtcacctgcac
ccgaagatcattgccgctgtgcaagagcaacttaccaagctgagccatacctgcttccag
gtgctggcctacgagccttacgtcgagctgtgcgagaagatcaacgccaaagtgccgggt
gatttcgacaagaaaaccctgctggtgaccaccggttccgaagcggttgaaaacgccgtg
aagatcgcgcgtgctgccactggccgtgcgggcgtgatcgccttcaccggcgcttaccac
ggtcgcactatgatgaccctgggcctgaccggtaaggttgtgccttactcggcgggcatg
ggcctgatgccgggcggtatcttccgcgcgctgtacccttgcgagctgcatggtgtgagc
gttgacgattccatcgccagcatcgagcgcatcttcaagaacgacgccgaacccaaggac
atcgctgcgatcatcatcgagccggttcagggcgaaggtggtttctacgtggcaccgaag
gcgttcatgctgcgtctgcgcgagctgtgcgacaagcacggcattttgctgatcgctgac
gaagtgcagaccggcgctggccgtaccggcacgttcttcgcgatggagcagatgggcgtt
gcggccgacctgaccaccttcgccaagtccatcgccggtggcttcccgctggcgggcgtg
tgcggcaaggctgaatacatggatgccatcgcaccgggcggtctgggcggcacttatgct
ggtagcccggttgcttgcgctgcggcgctggcggtgctggatatcttcgaagaagagcac
ctgctggaccgttgcaaggcggtgggcgagcgtctggtgactgcgctcaagggcattcag
gccaagtacccggtcattggcgaagtgcgtgcgctgggcgcgatgattgccgtcgagctg
ttcgaagatggcgattcgcacaagcctaacgccgcagcagtggtgcaggtagttgccaag
gcgcgtgacaagggtctgatcctgctgtcctgcggtacttacggcaacgtgttgcgcgta
ctggtaccgttgaccgctgaagacgaattgctgacccgtgggctggccattctggaagaa
tgcttcgctgaaatcgcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system