KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0144Help
Entry
PSPPH_0144        CDS       T00266                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSPPH_0144 (cysQ)
Enzymes [BR:psp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PSPPH_0144 (cysQ)
Transfer RNA biogenesis [BR:psp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PSPPH_0144 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
170100..170942
Genome map
AA seq 280 aa AA seqDB search
MTDSLQNLPHPLLAPVIELVRLAGEVILPFWRANVTVTTKTDDSPVTAADLAAHQVLVEG
LQALDRSIHVLSEEDADIPFSERAKWERWWLVDPLDGTKEFISGSEEFTVNVALIERGRV
VFGVVSMPTNNRCYFGGAGLGAWRSDDIDHLQPIAVRTQPGEGQTFTVVASRRHSSPEQE
HLLAGLSSGLGHLQLTNIGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEV
LQLDGKPFSYPARESLLNPFFLALPANAEWRDKLLVLAQS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgttacaaaacctgccacatccgctgctcgccccggtgattgaactggtc
cgcctggcgggcgaggtgatcctgccgttctggcgagccaatgtcaccgtcaccaccaag
accgacgactcgccagtgaccgccgccgacctggcagcccaccaggttttggtcgagggc
ttgcaggcgcttgatcggagcattcatgtgctctctgaagaagacgccgacatcccgttc
agcgagcgagcgaaatgggagcgctggtggctggtcgatccgctggatggtaccaaggag
tttatctccggcagtgaggagttcaccgtcaacgtcgcgctgattgagcgcggtcgtgtg
gtgttcggtgtggtgtcgatgcccaccaacaaccgttgttacttcggcggtgcagggctg
ggtgcctggcgcagtgatgacatcgaccacctccagccgattgccgtgcgcactcagccg
ggcgaagggcagacctttaccgtagtcgccagccgccgtcattccagtccggagcaggag
catttgctggctggcctgtcgagcgggcttgggcatttgcagctgaccaatatcggcagt
tcattgaaattctgcctgctggccgaaggtgctgccgattgctacccgcgactggccccg
acttcgcaatgggacactgctgcggcgcaaggcgtgcttgaaggcgctggcggcgaagtg
ctgcaactggacggcaaaccgttcagctacccggcacgcgaatcgctgctcaacccgttc
ttcctggcgttgcctgccaacgccgaatggcgcgacaaactgctggtgcttgcgcagtcc
tga

DBGET integrated database retrieval system