KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0144Help
Entry
PSPPH_0144        CDS       T00266                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psp00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
170100..170942
Genome map
AA seq 280 aa AA seqDB search
MTDSLQNLPHPLLAPVIELVRLAGEVILPFWRANVTVTTKTDDSPVTAADLAAHQVLVEG
LQALDRSIHVLSEEDADIPFSERAKWERWWLVDPLDGTKEFISGSEEFTVNVALIERGRV
VFGVVSMPTNNRCYFGGAGLGAWRSDDIDHLQPIAVRTQPGEGQTFTVVASRRHSSPEQE
HLLAGLSSGLGHLQLTNIGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEV
LQLDGKPFSYPARESLLNPFFLALPANAEWRDKLLVLAQS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgttacaaaacctgccacatccgctgctcgccccggtgattgaactggtc
cgcctggcgggcgaggtgatcctgccgttctggcgagccaatgtcaccgtcaccaccaag
accgacgactcgccagtgaccgccgccgacctggcagcccaccaggttttggtcgagggc
ttgcaggcgcttgatcggagcattcatgtgctctctgaagaagacgccgacatcccgttc
agcgagcgagcgaaatgggagcgctggtggctggtcgatccgctggatggtaccaaggag
tttatctccggcagtgaggagttcaccgtcaacgtcgcgctgattgagcgcggtcgtgtg
gtgttcggtgtggtgtcgatgcccaccaacaaccgttgttacttcggcggtgcagggctg
ggtgcctggcgcagtgatgacatcgaccacctccagccgattgccgtgcgcactcagccg
ggcgaagggcagacctttaccgtagtcgccagccgccgtcattccagtccggagcaggag
catttgctggctggcctgtcgagcgggcttgggcatttgcagctgaccaatatcggcagt
tcattgaaattctgcctgctggccgaaggtgctgccgattgctacccgcgactggccccg
acttcgcaatgggacactgctgcggcgcaaggcgtgcttgaaggcgctggcggcgaagtg
ctgcaactggacggcaaaccgttcagctacccggcacgcgaatcgctgctcaacccgttc
ttcctggcgttgcctgccaacgccgaatggcgcgacaaactgctggtgcttgcgcagtcc
tga

DBGET integrated database retrieval system