KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0207Help
Entry
PSPPH_0207        CDS       T00266                                 

Gene name
algC
Definition
alginate biosynthesis protein AlgC (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_0207 (algC)
   00030 Pentose phosphate pathway
    PSPPH_0207 (algC)
   00051 Fructose and mannose metabolism
    PSPPH_0207 (algC)
   00052 Galactose metabolism
    PSPPH_0207 (algC)
   00500 Starch and sucrose metabolism
    PSPPH_0207 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPPH_0207 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSPPH_0207 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPPH_0207 (algC)
Enzymes [BR:psp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSPPH_0207 (algC)
    5.4.2.8  phosphomannomutase
     PSPPH_0207 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243311..244708)
Genome map
AA seq 465 aa AA seqDB search
MNSPASVAPNLPETIFRAYDIRGVVGDTLNAETAYWIGRAIGSESLAQNEPNVSVGRDGR
LSGPELVQQLIQGLHDSGCHVSDVGLVPTPALYYAANVLAGKTGVMLTGSHNPKDYNGFK
IVIAGDTLANEQIQALHERIKTNNLTSQKGSITKVDILDRYFKQIKDDIVMARKLKVVVD
CGNGAAGVIAPQLIEALGCEVISLFAEVDGNFPNHHPDPGKLENLQDLIAKVKETGADLG
LAFDGDGDRVGVVTNKGNVVYPDRLLMLFALDVLKRNPGADIIFDVKCTRRLTPLISEHG
GRPVMWKTGHSLIKKEMKKSGALLAGEMSGHIFFKERWFGFDDGIYSAARLLEILSQESA
NAEDLFETFPNDISTPEINVKVTDVTKFSIIKALETDAQWGDAKLTTIDGVRVDYPKGWG
LVRASNTTPVLVLRFEAETEAELQRIKDVFHAELKKVAPDLDLPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcccagcatccgtggcacccaaccttcccgagactattttccgcgcctacgac
atccgtggcgtggtcggggacactctcaacgctgaaacggcttactggatcggccgcgcc
atcggctccgaaagcctggcgcagaacgaacccaacgtcagcgtcggtcgcgatggtcgc
ctttccggcccggaactggtgcagcaactgattcaaggcctgcacgacagcggctgccat
gtcagcgatgtgggcctggtgccgacgcctgcactgtattacgccgctaacgtgctggca
ggcaagaccggtgtgatgctgaccggcagccacaaccccaaggactacaacggcttcaag
atcgtcatcgccggcgacaccctcgccaacgagcagatccaggcgctgcacgagcgtatc
aagaccaacaacctgacttcgcagaaaggcagcatcactaaagtcgacatcctcgatcgc
tacttcaagcagatcaaggacgacatcgtcatggcccgcaagctgaaggtcgtggtcgac
tgcggcaacggcgcggcaggcgtgatcgccccgcagctgatcgaagcgctgggttgtgaa
gtgatctcgctgttcgcggaagtggacggcaacttccccaaccaccacccggacccgggc
aagctggaaaacctgcaggatctgatcgccaaggtcaaggaaaccggtgccgatctgggc
ctggcgttcgacggtgacggcgaccgtgtcggtgtcgtgaccaacaagggtaatgtggtt
tacccggatcgcctgttgatgctgttcgcgctggacgtgctcaagcgcaacccgggtgcc
gacatcattttcgacgtcaaatgcacacgtcgcctgactccgctgatcagcgaacatggc
ggtcgtccggtgatgtggaaaaccggccactcgctgatcaagaaagaaatgaaaaagagt
ggcgcgctgctcgcaggtgaaatgagcggccacatcttcttcaaggagcgctggttcggt
tttgacgacggcatctacagtgcggcacgtctgctggagatcctcagccaggagtcagcc
aatgccgaagacctgttcgaaaccttcccgaacgatatttcgacgcctgaaatcaacgtc
aaggtgacggatgtcaccaagttcagcatcatcaaggcccttgaaaccgacgcgcagtgg
ggcgacgccaaactgaccaccatcgacggtgtccgcgtggactatccgaagggttggggt
ctggtccgtgcgtccaataccacgccggtactggtgctgcgtttcgaggccgaaaccgag
gctgagttgcagcgcatcaaggacgtgttccacgctgagctgaaaaaagttgcaccggat
ctcgacctgccattttga

DBGET integrated database retrieval system