KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0255Help
Entry
PSPPH_0255        CDS       T00266                                 

Definition
(GenBank) diguanylate cyclase, putative
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PSPPH_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(295035..297095)
Genome map
AA seq 686 aa AA seqDB search
MSDDAERWKEKYLKGIEQQDKLEKRWDARLDLLRRGLVRSSLAAEGSDRAVDECMKEMRE
IVRKDDMDAGLAALIPRLEKAVLDSEHRREVRVGQIGSALTALVAQLQALPLPREVRKPL
KRFAKDLEERASQARELPLLLSELSGLQGQALTLLEKHEEGPRQGLLQRLFGSRDEHGNE
RPPEAAHPENAPSAQETHETHVQPEAANAQAPIDVAAAEVEAAIAPDIVNQKTKDAHTLP
PQVSEAETAIVTAPETPVPSPAAAALAPALAETVTEPAVVPVEPIDFTDLLGPVPSVPYQ
QRPAPIIQALEQPQEDAESETETVEGEEGYSLPSSPEPSYSSVAAHIEETLLGLLDDLTL
SEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLMLAINNGGQQEFSTYLKQLNERLESF
QSHLQAASEDHAEDQSTARDLNEQLREQVGGLQISVQDASDLTSLKQVLDNRFEGLLSTM
DHYQLKRDAREREVASRLQGLSARVASMEQEALGFRTHLEEQRQKALIDPLTGLPNRAAW
GERLEQEMSKWQHEKNSLLVCILDLDHFKRINDGYGHLAGDKVLKIVANVFRKRLRSDDF
LARFGGEEFVMLLPATPPGTGLTLLDELRAAVESCPFHFKGERVTITVSIGVTAFRTAER
SDTAIKRADQALYRAKENGRNRVEQG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgcggagcgttggaaagagaagtacctcaagggaatcgagcaacaggat
aagctcgaaaagcgctgggatgcgcggctcgacttgctgcgccgcggtctggtgcgcagc
agcctggcagcagaaggctctgaccgcgccgtcgatgaatgcatgaaggaaatgcgcgaa
attgtccgcaaggacgatatggacgccggtctggcagccttgattccgcgcctcgaaaaa
gccgtactggactccgagcatcgccgtgaagtacgggtcgggcaaattggctcggcactg
accgcactggttgcacaactgcaagcgctaccgttgccacgagaggtacgcaagccactc
aagcgctttgccaaggaccttgaagaacgtgcatcgcaggcgcgcgagctgcctttgctg
ctcagcgagttgagtggtttgcagggccaggccctgaccctgctcgaaaagcacgaagag
ggcccacgccaagggcttctgcagcgtttgttcggttcgcgggacgaacatggcaatgag
cgccctcccgaggctgcccaccccgaaaacgccccttctgctcaggaaacgcatgagacg
cacgtgcaacctgaggccgcgaacgctcaagcgccgatagacgttgccgcagcggaagta
gaagctgccattgcccccgacatcgtcaaccagaagacaaaggacgcacacacactgccg
ccacaggtttcagaagccgaaaccgctatcgttacggcacctgaaacacctgtgccatcg
ccagccgcagcagcccttgctccagccctggccgaaacagtcaccgaacctgcggttgtc
cctgtcgagcctatcgatttcactgacctgctgggccccgttccttcagtgccctaccag
caacggcctgctccaatcatccaggcactggaacagccgcaagaggatgccgaatcagaa
accgaaacggtggaaggcgaagagggttattcgctgccctcctcgccagaacccagctac
agctcggtggcggcacacattgaggaaaccctgctgggcctgctcgatgacctgaccttg
tcggagcacttccgcccgcaggtcgaggacatgcagttacgcttgaaacatgggctcaac
tggtacgaactgctaccgatcctcgacgatctggcagttctgatgctggcaatcaacaac
ggcggccaacaggaattcagcacctacctcaaacaactcaatgagcggctcgaatcgttt
cagagccatttgcaggctgccagtgaagatcatgccgaggatcagtccacagcccgcgac
ctgaacgagcagttgcgcgaacaggtgggcggcctgcagatcagcgttcaggacgcttcc
gacctgaccagtctcaagcaggtgctcgacaaccgctttgaaggcttgctcagcaccatg
gaccactaccagctcaagcgtgacgcacgcgagcgggaagttgcctcgcggctgcaaggc
ctttcggcccgcgttgcgagcatggagcaggaagcgctgggtttcaggactcacctggaa
gaacagcgccaaaaggccttgatcgacccgctcaccggcctgcccaatcgcgcagcctgg
ggcgagcgcctcgaacaggagatgagcaagtggcaacacgagaaaaacagcctgctggtg
tgcattctggacttggaccacttcaagcgcatcaatgacggatatggccacctggcaggc
gataaagtgctgaagatcgtcgccaacgttttcaggaaacgcctgcgcagcgacgatttt
ctcgcccggtttggcggtgaggaatttgtcatgctgttgcctgctacgcctcccggcacc
gggctgacgttgctcgacgaacttcgagctgcggtggagtcatgcccgtttcacttcaag
ggcgagcgcgtgacgatcaccgtatctattggagtgacggcttttcgaacggctgaacgc
agtgacactgcgatcaagcgcgccgatcaggcgctgtacagggccaaggaaaatggccga
aacagggtcgaacaaggctga

DBGET integrated database retrieval system