KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0255Help
Entry
PSPPH_0255        CDS       T00266                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(295035..297095)
Genome map
AA seq 686 aa AA seqDB search
MSDDAERWKEKYLKGIEQQDKLEKRWDARLDLLRRGLVRSSLAAEGSDRAVDECMKEMRE
IVRKDDMDAGLAALIPRLEKAVLDSEHRREVRVGQIGSALTALVAQLQALPLPREVRKPL
KRFAKDLEERASQARELPLLLSELSGLQGQALTLLEKHEEGPRQGLLQRLFGSRDEHGNE
RPPEAAHPENAPSAQETHETHVQPEAANAQAPIDVAAAEVEAAIAPDIVNQKTKDAHTLP
PQVSEAETAIVTAPETPVPSPAAAALAPALAETVTEPAVVPVEPIDFTDLLGPVPSVPYQ
QRPAPIIQALEQPQEDAESETETVEGEEGYSLPSSPEPSYSSVAAHIEETLLGLLDDLTL
SEHFRPQVEDMQLRLKHGLNWYELLPILDDLAVLMLAINNGGQQEFSTYLKQLNERLESF
QSHLQAASEDHAEDQSTARDLNEQLREQVGGLQISVQDASDLTSLKQVLDNRFEGLLSTM
DHYQLKRDAREREVASRLQGLSARVASMEQEALGFRTHLEEQRQKALIDPLTGLPNRAAW
GERLEQEMSKWQHEKNSLLVCILDLDHFKRINDGYGHLAGDKVLKIVANVFRKRLRSDDF
LARFGGEEFVMLLPATPPGTGLTLLDELRAAVESCPFHFKGERVTITVSIGVTAFRTAER
SDTAIKRADQALYRAKENGRNRVEQG
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgcggagcgttggaaagagaagtacctcaagggaatcgagcaacaggat
aagctcgaaaagcgctgggatgcgcggctcgacttgctgcgccgcggtctggtgcgcagc
agcctggcagcagaaggctctgaccgcgccgtcgatgaatgcatgaaggaaatgcgcgaa
attgtccgcaaggacgatatggacgccggtctggcagccttgattccgcgcctcgaaaaa
gccgtactggactccgagcatcgccgtgaagtacgggtcgggcaaattggctcggcactg
accgcactggttgcacaactgcaagcgctaccgttgccacgagaggtacgcaagccactc
aagcgctttgccaaggaccttgaagaacgtgcatcgcaggcgcgcgagctgcctttgctg
ctcagcgagttgagtggtttgcagggccaggccctgaccctgctcgaaaagcacgaagag
ggcccacgccaagggcttctgcagcgtttgttcggttcgcgggacgaacatggcaatgag
cgccctcccgaggctgcccaccccgaaaacgccccttctgctcaggaaacgcatgagacg
cacgtgcaacctgaggccgcgaacgctcaagcgccgatagacgttgccgcagcggaagta
gaagctgccattgcccccgacatcgtcaaccagaagacaaaggacgcacacacactgccg
ccacaggtttcagaagccgaaaccgctatcgttacggcacctgaaacacctgtgccatcg
ccagccgcagcagcccttgctccagccctggccgaaacagtcaccgaacctgcggttgtc
cctgtcgagcctatcgatttcactgacctgctgggccccgttccttcagtgccctaccag
caacggcctgctccaatcatccaggcactggaacagccgcaagaggatgccgaatcagaa
accgaaacggtggaaggcgaagagggttattcgctgccctcctcgccagaacccagctac
agctcggtggcggcacacattgaggaaaccctgctgggcctgctcgatgacctgaccttg
tcggagcacttccgcccgcaggtcgaggacatgcagttacgcttgaaacatgggctcaac
tggtacgaactgctaccgatcctcgacgatctggcagttctgatgctggcaatcaacaac
ggcggccaacaggaattcagcacctacctcaaacaactcaatgagcggctcgaatcgttt
cagagccatttgcaggctgccagtgaagatcatgccgaggatcagtccacagcccgcgac
ctgaacgagcagttgcgcgaacaggtgggcggcctgcagatcagcgttcaggacgcttcc
gacctgaccagtctcaagcaggtgctcgacaaccgctttgaaggcttgctcagcaccatg
gaccactaccagctcaagcgtgacgcacgcgagcgggaagttgcctcgcggctgcaaggc
ctttcggcccgcgttgcgagcatggagcaggaagcgctgggtttcaggactcacctggaa
gaacagcgccaaaaggccttgatcgacccgctcaccggcctgcccaatcgcgcagcctgg
ggcgagcgcctcgaacaggagatgagcaagtggcaacacgagaaaaacagcctgctggtg
tgcattctggacttggaccacttcaagcgcatcaatgacggatatggccacctggcaggc
gataaagtgctgaagatcgtcgccaacgttttcaggaaacgcctgcgcagcgacgatttt
ctcgcccggtttggcggtgaggaatttgtcatgctgttgcctgctacgcctcccggcacc
gggctgacgttgctcgacgaacttcgagctgcggtggagtcatgcccgtttcacttcaag
ggcgagcgcgtgacgatcaccgtatctattggagtgacggcttttcgaacggctgaacgc
agtgacactgcgatcaagcgcgccgatcaggcgctgtacagggccaaggaaaatggccga
aacagggtcgaacaaggctga

DBGET integrated database retrieval system