KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0279Help
Entry
PSPPH_0279        CDS       T00266                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPPH_0279 (hemB)
Enzymes [BR:psp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PSPPH_0279 (hemB)
Exosome [BR:psp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPPH_0279 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
321012..322022
Genome map
AA seq 336 aa AA seqDB search
MSFTPANRLFPLTRLRRNRRDDFSRRLVRENVVTVDDLILPVFVLDGENRRESIASMPGV
ERLSVDLLLEEAEHWVALGIPALALFPVTPAEKKSLDGAEAWNPDGIAQRATRALRDRFP
ELGVITDVALDPFTTHGQDGILDEEGYVQNDITVDALVKQALSHADAGAQVIAPSDMMDG
RIQAIRESLELAGHVNVRIMAYSAKYASAYYGPFRDAVGSSLNLGKANKASYQMDPANSN
EALHEVAADLAEGADMVMVKPGMPYLDILHRVKDEFKVPTFVYQVSGEYAMHMAAIQNGW
LSEGVILESLTAFKRAGADGILTYFAVRAAQLLKGQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttacccccgcaaaccgcctgtttcctctcactcgtctgcgccgtaatcgccgc
gacgacttttcccgtaggctggtgcgtgaaaacgttgtcaccgttgatgatctgattctc
cccgtattcgtcctcgatggtgaaaaccgtcgtgaatccattgcctcgatgcctggcgtc
gagcgtctcagtgtcgatctgttgcttgaggaagccgagcactgggtcgcactgggcatt
ccagcgctggccttgttcccggtaacgccggccgagaaaaaatctctggacggcgctgaa
gcctggaacccggatggcattgcgcaacgcgccacccgcgcgttgcgtgaccgcttcccg
gagctgggcgtcatcactgatgtggcgctggacccgtttaccacccatggtcaggacggc
atcctcgacgaagagggctatgtgcagaacgacatcactgtcgatgcactggtgaagcag
gccttgtcgcacgccgatgcaggcgctcaggtgatcgcgccttcggacatgatggacggt
cgtatccaggccatccgtgagtcgctggagctggccgggcacgtcaatgtgcggatcatg
gcctactcggccaaatacgccagtgcctattacggcccgttccgtgatgcggtgggttct
tcgctgaatctgggcaaggccaacaaggcgtcctatcagatggacccggccaacagcaac
gaggcactgcacgaagtcgcagctgacttggctgaaggtgccgacatggtgatggtcaag
ccgggcatgccttatctggacatcctgcacagggtcaaggatgagttcaaagtgccgacc
tttgtctatcaggtcagtggtgaatacgcgatgcacatggcagcaatccagaatggttgg
ctgagtgaaggggttattctcgagtccctcacagccttcaaacgcgccggtgccgacggc
atccttacctacttcgctgttcgcgccgctcaactgttgaaggggcaatag

DBGET integrated database retrieval system