KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0625Help
Entry
PSPPH_0625        CDS       T00266                                 

Gene name
folK1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPPH_0625 (folK1)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSPPH_0625 (folK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
739616..740140
Genome map
AA seq 174 aa AA seqDB search
MSLTRIFLGLGSNIERERHLHAGLDALDGFLTDLSCSPVFESHAVGIKSGPFFNLVVSAL
TDLPLMELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGEQVGNFDGLILPRAEILKNAF
VLCPLALIAPERLHPGVGIAFSKLWADAQIDQQLWPVAFEWRGVSLTPESLLRS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgacgcggattttcctcggcctggggagcaatatcgagcgcgaacgtcacctg
catgccgggctggatgcgctggatggctttctgactgacctcagttgctcgccggttttt
gaaagccatgcggtgggcatcaagagcgggccattcttcaatctggtggtgtcggcgttg
accgatctgccgttgatggagcttgatcgccgcctgaaattcatcgaggccgataatggc
cgctatgccccggatcgcaaagggctgccgctggatatcgatgtgctgttgtatggcgag
caggtcggcaatttcgacgggctgattttgcccagagcggagattctgaagaatgccttc
gtgctgtgcccgttggcattgattgcccctgagcgtctgcatccgggtgtggggattgcc
ttcagcaagctttgggctgacgcgcagatcgatcagcagctctggcctgtggcttttgaa
tggcgcggcgtgagccttacgcctgagagtctgctgcgtagctga

DBGET integrated database retrieval system