KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0674Help
Entry
PSPPH_0674        CDS       T00266                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPPH_0674 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPPH_0674 (trpC)
Enzymes [BR:psp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PSPPH_0674 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
790424..791260
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLEKILVRKAEEIAARRAIVSLAELEQQVASVDAPRGFANALITQARLKLPAVIA
EVKKASPSKGVIRENFLPGEIARSYQAGGATCLSVLTDVDFFQGSDAYLQEARAACNLPV
IRKDFMIDPYQVVEARALGADCILLIVSALEDGQMAELADVAKRVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLELLPRIPRDRLVITESGILNRADVELMEIND
VYSFLVGEAFMRAEHPGAELLRLFFPERKLAASGPSID
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgccaaccgtactggaaaagattcttgtccgaaaggccgaggaaattgcggcc
cgtcgagcaattgtcagcctcgccgaacttgaacaacaggtcgccagcgtcgatgcgcca
cgtggctttgccaacgcgctgatcactcaggccaggttgaagctgcctgccgtcatcgca
gaagtcaaaaaggcgtctccaagcaaaggcgttatccgggagaattttctgccgggcgag
atcgccagaagttatcaggcgggaggcgcgacctgtctttcagtgctcactgatgtcgat
ttctttcagggttccgatgcctatcttcaggaagcgcgggcggcgtgcaatttgccggtg
atccgtaaggatttcatgatcgatccttatcaagtggtcgaggctcgcgcgctgggcgct
gactgcattctgctgatcgtgtcggcactggaagacgggcaaatggctgagctggccgac
gttgccaagcgtgtcgggctggacgtactggtcgaggtgcacgacggcgacgagctggag
cgcgcactcaagacgcttgatacaccgctggtgggtgtcaacaatcgcaacctccacacc
tttgaagtgagcctggaaaccacgctggagttgctaccgcgcatcccgcgtgatcgcttg
gtcattaccgaaagcggcattctcaatcgtgcggatgtcgagctgatggaaatcaacgat
gtctattcgttcctggtgggcgaggctttcatgcgcgccgaacatccgggcgccgagttg
ctgcggctgttctttccggagcgcaagcttgcggcgagcggcccgtccatcgactga

DBGET integrated database retrieval system