KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0674Help
Entry
PSPPH_0674        CDS       T00266                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01130  Biosynthesis of antibiotics
psp01230  Biosynthesis of amino acids
Module
psp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPPH_0674 (trpC)
Enzymes [BR:psp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PSPPH_0674 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AAZ37713
UniProt: Q48NP7
Position
790424..791260
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLEKILVRKAEEIAARRAIVSLAELEQQVASVDAPRGFANALITQARLKLPAVIA
EVKKASPSKGVIRENFLPGEIARSYQAGGATCLSVLTDVDFFQGSDAYLQEARAACNLPV
IRKDFMIDPYQVVEARALGADCILLIVSALEDGQMAELADVAKRVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLELLPRIPRDRLVITESGILNRADVELMEIND
VYSFLVGEAFMRAEHPGAELLRLFFPERKLAASGPSID
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgccaaccgtactggaaaagattcttgtccgaaaggccgaggaaattgcggcc
cgtcgagcaattgtcagcctcgccgaacttgaacaacaggtcgccagcgtcgatgcgcca
cgtggctttgccaacgcgctgatcactcaggccaggttgaagctgcctgccgtcatcgca
gaagtcaaaaaggcgtctccaagcaaaggcgttatccgggagaattttctgccgggcgag
atcgccagaagttatcaggcgggaggcgcgacctgtctttcagtgctcactgatgtcgat
ttctttcagggttccgatgcctatcttcaggaagcgcgggcggcgtgcaatttgccggtg
atccgtaaggatttcatgatcgatccttatcaagtggtcgaggctcgcgcgctgggcgct
gactgcattctgctgatcgtgtcggcactggaagacgggcaaatggctgagctggccgac
gttgccaagcgtgtcgggctggacgtactggtcgaggtgcacgacggcgacgagctggag
cgcgcactcaagacgcttgatacaccgctggtgggtgtcaacaatcgcaacctccacacc
tttgaagtgagcctggaaaccacgctggagttgctaccgcgcatcccgcgtgatcgcttg
gtcattaccgaaagcggcattctcaatcgtgcggatgtcgagctgatggaaatcaacgat
gtctattcgttcctggtgggcgaggctttcatgcgcgccgaacatccgggcgccgagttg
ctgcggctgttctttccggagcgcaagcttgcggcgagcggcccgtccatcgactga

DBGET integrated database retrieval system