KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0716Help
Entry
PSPPH_0716        CDS       T00266                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPPH_0716 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSPPH_0716 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PSPPH_0716 (proB)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PSPPH_0716 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
839137..840243
Genome map
AA seq 368 aa AA seqDB search
MTGAQRWVVKIGSALLTADGKGLDRNAMGVWVEQMAALHEAGVELVLVSSGAVAAGMSRL
GWTARPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLNARST
LRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFDADPR
NNPEAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGGRIER
VLARLKGGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDDGAVAALAKDQKSLLPVG
VKLVQGSFRRGEMVVCVASDGREIARGLSNYSAIEAQKIIGHSSESIVRELGYMAEPELI
HRDNLILV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgcccagcgctgggttgtgaagattggcagtgccttgctgaccgcggatggc
aagggcctggatcgcaacgccatgggtgtttgggtggagcagatggcggcgctgcatgag
gcgggtgtcgagctggtgctggtgtcttccggggcggtggctgccggtatgagccgtctt
ggctggacggcccgacccagcgccatgcatgagctccaggctgctgcggccatcggtcag
atgggcttggtgcaggcgtgggaatcgagttttgccgagcacggccggcataccgcgcaa
attctgctgacccatgacgacctgtcggaccgcaagcgctacctcaatgcccgcagtacc
ctgcgcacgctggtcgagcttggggttgtgccggtcatcaacgaaaatgacacagtggtc
accgacgaaatccgttttggcgataacgacacgctggcggcgctggttgccaatctggtc
gaggcagatctgttggtcatcctgactgaccgcgacggcatgttcgacgctgatccgcgc
aacaacccggaggctcagctgatctacgaagcgcgcgccgatgaccctgcgctggatgct
gtggctggtggtacaggtggcgcactggggcgcggtggtatgcagaccaagttacgcgct
gcgcggttggcggcgcgttccggtgcgcataccgtcattgtcggtgggcgtatagagcgc
gtgctggcgcggctcaagggtggcgaacgtttggggacattgctgtctcccgagcgcggc
atgctcgcggcgcgcaagcagtggctggcagggcacctgcaaactcgcggcacgctggtg
ctggatgatggcgctgttgcggcgctggccaaggatcagaaaagcctgctaccggtgggt
gtcaagctggtccagggcagcttccggcgtggcgagatggtggtatgcgttgcctcggac
ggtcgcgagatcgctcgcgggctgagcaactacagtgctatcgaagcccagaaaatcatt
ggtcactcttccgaatccatcgtgcgcgagctgggatatatggccgagcctgagctgatt
catcgggataacctgatcctcgtctga

DBGET integrated database retrieval system