KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0800Help
Entry
PSPPH_0800        CDS       T00266                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPPH_0800 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSPPH_0800 (cheB1)
Enzymes [BR:psp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSPPH_0800 (cheB1)
Two-component system [BR:psp02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PSPPH_0800 (cheB1)
Bacterial motility proteins [BR:psp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSPPH_0800 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(944617..945693)
Genome map
AA seq 358 aa AA seqDB search
MPNKKISVLLVDDSAVVRQVLVAILNDTPDIHVMGAATDPIFAMAKLAQEWPDVIVLDVE
MPRMDGITFLKKIMSERPTPVVICSSLTQKGAETSLQALSAGAVEIITKPTTGLKNFLID
SAAELVAAVRAAANSNVKNLGKRMAPPVLAPASKLTADAILPAASGHAMAQTTERIVAIG
TSTGGTQALEAVLTALPRVCPGMVIVQHMPEKFTASFAERLNGLSQIEVPEARNNDRILP
GLALIAPGGKHMMVTRSGASYYVQVIDGPLVNRHRPSVDVLFRSVAKFAGKNATGIIMTG
MGDDGARGLKEMLDAGSSTVAQDEASCVVFGMPKEAIKLNAAQRIMPLQEIHQAILHR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaaaaatcagcgtattgctggtcgatgattcggccgtcgttcgccaggta
ctcgtggccattctcaacgacacccccgatattcatgtcatgggcgcggcgacggacccg
atatttgccatggccaagctggctcaggaatggccggacgtcatcgtgctggacgtggaa
atgccccgcatggacggcatcacctttctcaagaagatcatgagcgaacggccgacacca
gtggtgatctgctcgtcgctgacccagaaaggcgcagaaacttcgttgcaggcgctgtct
gccggggcggtggaaatcatcaccaaacctaccaccggcctgaagaacttcctcattgat
tcagccgccgagctggtcgcggcagtccgcgcagcggcgaactccaacgtcaaaaacctc
ggtaagcgcatggctccgcccgttctggccccggcaagcaaactcaccgcagacgccatt
ttgcccgcagccagcggtcacgccatggcgcagaccaccgagcgcattgtggccatcggc
acctcgaccggcggcactcaggcactggaagcggtgctgactgccctgcccagagtctgt
ccgggcatggtcatcgttcagcacatgccggaaaaattcactgcctcgttcgccgaacgt
ctcaatggcttgtcgcagatcgaggtacccgaagccagaaacaacgaccgcatcctgccc
ggcctggccctgattgcgcccggcggcaaacacatgatggtcactcgcagcggtgcctct
tactacgttcaggtcatcgacggcccactggtcaaccgccaccgcccttcagtggacgtg
ctgtttcgttcggtggccaaattcgctggcaagaatgctacgggcatcatcatgaccggc
atgggcgacgacggcgcacgcggtttaaaggagatgcttgatgccggaagctcgacagtg
gctcaggatgaagccagttgcgtcgtattcggcatgcccaaggaagccatcaaactgaat
gctgcgcagaggatcatgccactacaggaaattcatcaggcgatattgcaccgatga

DBGET integrated database retrieval system