KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0855Help
Entry
PSPPH_0855        CDS       T00266                                 

Gene name
folK2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1022575..1023081)
Genome map
AA seq 168 aa AA seqDB search
MNEPLLTTERVYIGLGSNLADPAEQLRGALKAMAQLPDCELTSVSSFYVSDSLLPGQPRF
TNAVAALDTTLTPLTLLDALQAIELDQGRERHERWGPRTLDLDILLFGNRLIDEPRLKVP
HYHMQARAFVLYPLAELAPGLTLADGRELDRLLEDCPFTGLERLPAEA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaccgctgttgaccactgaacgcgtttacatcggcctgggcagtaatcttgct
gacccggctgagcaattgcgcggtgccctcaaggcaatggcacaactacccgattgtgaa
ctgaccagcgtgtcatcgttctatgtcagcgactcgttgctgcccggccagccgcgcttt
accaacgccgtcgcagcactcgacactaccctgacgccactgaccctgctggacgcccta
caggccatcgagctggatcagggccgcgaacgccatgaacgctgggggcctcgcacgctg
gacctcgacattctgctgttcggcaatcgcctgatcgatgaaccgcgcctcaaggtgccg
cattaccacatgcaggcgcgggcattcgtgctgtacccgctggcagagctggccccaggc
ctgacgctggccgacggacgcgaactcgatcgtctacttgaagactgcccgtttacgggc
cttgaacgcctgcccgccgaggcataa

DBGET integrated database retrieval system