KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0897Help
Entry
PSPPH_0897        CDS       T00266                                 

Definition
alkylphosphonate utilization protein PhnA
Orthology
K06193  
phosphonoacetate hydrolase [EC:3.11.1.2]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Phosphonate and phosphinate metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PSPPH_0897
Enzymes [BR:psp01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.2  phosphonoacetate hydrolase
     PSPPH_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1069139..1069480
Genome map
AA seq 113 aa AA seqDB search
MSLPSCPKCNSEYTYEDGSLLICPECAHEWSADAAGADAADDVKVIKDSTGNVLQDGDTI
TVIKDLRVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttaccgtcctgcccgaaatgcaattccgaatacacctacgaagacggcagcctg
ctgatctgcccggaatgcgcccatgaatggtctgcagacgctgctggcgccgatgcagcc
gacgacgtgaaagtcatcaaggactccacgggaaatgtgctgcaggacggcgataccatt
accgtgatcaaggacctgagggtcaaaggctcttcgctggtggtcaaggtcggtaccaag
gtcaagaacatccgtctggtcgatggcgaccacgatatcgattgcaagatcgacggcatc
ggcgcgatgaagctgaagtccgagttcgtccgcaaggtttga

DBGET integrated database retrieval system