KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0897Help
Entry
PSPPH_0897        CDS       T00266                                 

Definition
(GenBank) alkylphosphonate utilization operon protein PhnA, putative
  KO
K06193  protein PhnA
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp01120  Microbial metabolism in diverse environments
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnA PhnA_Zn_Ribbon TF_Zn_Ribbon OrfB_Zn_ribbon zinc-ribbons_6 DUF2318 DNA_RNApol_7kD UPF0547 zf-RRN7 A2L_zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AAZ34829
UniProt: Q48N49
Position
1069139..1069480
Genome map
AA seq 113 aa AA seqDB search
MSLPSCPKCNSEYTYEDGSLLICPECAHEWSADAAGADAADDVKVIKDSTGNVLQDGDTI
TVIKDLRVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttaccgtcctgcccgaaatgcaattccgaatacacctacgaagacggcagcctg
ctgatctgcccggaatgcgcccatgaatggtctgcagacgctgctggcgccgatgcagcc
gacgacgtgaaagtcatcaaggactccacgggaaatgtgctgcaggacggcgataccatt
accgtgatcaaggacctgagggtcaaaggctcttcgctggtggtcaaggtcggtaccaag
gtcaagaacatccgtctggtcgatggcgaccacgatatcgattgcaagatcgacggcatc
ggcgcgatgaagctgaagtccgagttcgtccgcaaggtttga

DBGET integrated database retrieval system