KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0897Help
Entry
PSPPH_0897        CDS       T00266                                 

Definition
(GenBank) alkylphosphonate utilization operon protein PhnA, putative
  KO
K06193  
protein PhnA
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Microbial metabolism in diverse environments
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1069139..1069480
Genome map
AA seq 113 aa AA seqDB search
MSLPSCPKCNSEYTYEDGSLLICPECAHEWSADAAGADAADDVKVIKDSTGNVLQDGDTI
TVIKDLRVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKV
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttaccgtcctgcccgaaatgcaattccgaatacacctacgaagacggcagcctg
ctgatctgcccggaatgcgcccatgaatggtctgcagacgctgctggcgccgatgcagcc
gacgacgtgaaagtcatcaaggactccacgggaaatgtgctgcaggacggcgataccatt
accgtgatcaaggacctgagggtcaaaggctcttcgctggtggtcaaggtcggtaccaag
gtcaagaacatccgtctggtcgatggcgaccacgatatcgattgcaagatcgacggcatc
ggcgcgatgaagctgaagtccgagttcgtccgcaaggtttga

DBGET integrated database retrieval system