KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_0910Help
Entry
PSPPH_0910        CDS       T00266                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.3.1 3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:psp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:psp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1083881..1085452)
Genome map
AA seq 523 aa AA seqDB search
MTDFNPDRRRIITGVAGATLLSILSPFARSAGVDYPFTLGVASGDPLPDGFVIWTRLAPQ
VMTATGDGGLKKPVEVRWKIASDAAMTRVVRTGQATAQPRFAHSVHVEVGGLQPGRPYWY
QFESLGAQSAVGQACTAPLATTMVSARFGFVSCSHWEAGYFSAYRHLAAERPDMVFFLGD
YIYEMNVSPTNIQFPRRHATSDPMDLAGYRNRYAQYKTDPDLQALHACAPSVATWDDHEV
QNDYAAQWSQDPNVPVDSFLRRRAAAYQAFYEHMPLRAGSLPKGPDMRIYRNLDYGRLAR
FHVLDGRQYRSEQACIQANGSRRGYVAPSDCPDLSDPKRTMLGWEQEAWLDRSFAESPGQ
WNVIAQDLLVAPLEQRNLKTQALGHWTDGWDGYAATRERMLASLQRQQTRNPVFWGGDIH
SFWTTDLHADAGNPDSAVVATEFVGTSVTSGGPPFDAFNSILGLNPHVKFFDSRQRGYVA
VDLSEQQMLTRFQVVSDVLDPAASVSTLKRFAVEAGKAGAVSG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttcaatccggatcgccgacgcatcattaccggcgtggccggtgccacgctg
ctatcgatcctcagcccgtttgcccgcagcgcgggtgtcgattatccgttcacgctgggc
gtggcatccggcgacccgctgcctgacggcttcgtgatctggacacgcctggcgccacag
gtgatgacagccacgggcgatggcggcctgaaaaaacccgtcgaagtgcgctggaaaatc
gccagcgatgcagcgatgactcgtgtagtacgtacaggacaagcgaccgcccaaccgcgc
tttgcccattcggtacatgttgaagtgggcggtttgcagcctggacgtccctactggtat
cagttcgaaagtctgggcgcgcaaagcgccgtgggtcaggcctgcactgcgccgctggca
accaccatggtctcggcacggttcggcttcgtgtcatgttcgcattgggaggcaggatat
ttcagcgcctacaggcacctggctgcagagcgtcctgacatggtgttctttctgggtgat
tacatctatgaaatgaacgtctctcccacaaacatacagttcccgcgacgccatgccacc
tcagacccgatggacctggcgggctatcgcaaccgatacgcgcagtacaagaccgaccct
gacctgcaagcgctgcatgcctgcgcgccgagcgtggccacctgggacgatcacgaagta
cagaatgactacgcggcgcagtggtcccaggacccgaatgttccggtggacagctttctg
cgtcgcagagccgccgcttatcaggcgttttacgagcacatgcccttgcgcgccggcagc
ctgcccaaaggtccggacatgcgtatttaccggaacctggactatggccgcctggcgcgc
ttccatgtgctggacggtcggcagtatcgttccgaacaggcgtgcatccaggccaacggc
agccgtcgaggctacgtagcgcccagcgactgtccggatctgagtgaccccaaacgcacc
atgctcggctgggaacaggaagcctggctggaccgcagcttcgctgaatcacctgggcaa
tggaatgtcattgcccaggacttgctggtcgctccactggaacagcgcaatctcaaaacg
caggcactgggccactggaccgacggctgggacggctacgcggcgacccgcgagcgcatg
ctggcatccctgcaacgccagcagacccgcaacccggtgttctggggtggcgatatccat
tcgttctggaccaccgacctgcacgccgatgcgggcaatccggattccgccgtcgtcgcc
actgaattcgtcggcacctcggtgacatccggcggaccaccattcgacgccttcaacagt
attctggggctcaacccccacgtgaaattctttgacagccgccagcgtggctatgtggca
gtggacctcagtgagcagcagatgctgacccgcttccaggtagtgtcggatgtgctcgac
cccgctgccagtgtgtcgacgctcaaacgctttgcggtggaggctggcaaggccggggcg
gtttctgggtag

DBGET integrated database retrieval system