KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_0993Help
Entry
PSPPH_0993        CDS       T00266                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00900  Terpenoid backbone biosynthesis
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPPH_0993 (ispE)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSPPH_0993 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AAZ37323
UniProt: Q48MV8
Position
complement(1186253..1187119)
Genome map
AA seq 288 aa AA seqDB search
MTALQDMAKAQLVLPAPAKLNLMLHILGRRPDGYHELQTLFQFLDYGDELGFTVREDGEI
RLQTDVPGVPHDSNLIVKAARALQKQSGCTLGMDIWLEKRLPMGGGIGGGSSDAATTLLA
LNHLWQLGWDEDRLAQLGLTLGADVPVFVRGHAAFAEGVGEILTPVDPEEPWYLVLVPQV
AVSTAEIFSDPLLTRDTPPIKVRPVPKGNSRNDCKAVVERRYPEVRNALNLLGNFTEAKL
TGTGSCVFGAFPNKAEADKVSALLTETLTGFVAKGSNISMLHRKLQIL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattacaggatatggccaaggcccagctggttttgcctgctccggcaaagctg
aacctgatgctgcacattctgggacgccgtccggacggctaccatgagttgcaaaccctg
tttcagtttctcgattacggtgacgaactgggctttaccgttcgcgaggacggcgagatt
cgcctgcagaccgatgtccccggtgtcccgcatgacagcaacctgatcgtcaaagccgcc
cgcgcgctgcaaaaacagtccggttgcacactgggcatggatatctggctggaaaaacgc
ttgcccatgggcggcggcatcggcggcggcagctcggatgctgccaccacactgctggcg
ctgaatcatttgtggcagcttggctgggatgaagatcgtctggcgcaactgggcctgact
ctgggcgctgatgtaccggtttttgtccgtggacacgccgcatttgctgagggtgtcggg
gaaattctcaccccggttgaccccgaagaaccctggtatttggtgctcgttccgcaagtc
gctgtaagtacagcagaaattttttcagatccgttgttgacacgcgacacgccgcccatt
aaagtgcgccccgttcccaagggaaacagtcgaaatgactgtaaggcggttgtagagagg
cgttacccagaagtacgtaacgctttgaatttgttaggtaattttaccgaagcaaaatta
accggaactggaagttgtgtgtttggggcattcccaaacaaagctgaagctgataaagtc
tcggcccttcttacagagacccttacagggttcgtagcgaaaggaagtaacatttcgatg
ttgcatcgcaagctgcaaattctgtaa

DBGET integrated database retrieval system