KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1059Help
Entry
PSPPH_1059        CDS       T00266                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1251347..1251835
Genome map
AA seq 162 aa AA seqDB search
MSAFHDIKLKALGGQELPMAGFKNKVVLVVNVASKCGLTPQYAALENLYQQYKDKGLEIL
GLPCNQFAGQEPGSEKEIAEFCELNYGVTFTLGEKLDVNGPDRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKNGGVSARFSPRTAPDDPAVIQAIEKALAQS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttcacgacatcaaattgaaagcgctgggtggtcaggaactgccgatggcg
ggtttcaagaacaaagtggttctggtggtcaacgtcgcgtccaaatgcgggctgacaccg
caatacgcagcacttgaaaacctctatcagcaatacaaggacaagggcctggagattctc
gggctgccgtgcaaccagtttgccgggcaggaaccgggcagcgaaaaagagatcgccgaa
ttttgcgaactcaattacggcgtgacctttacgctgggtgaaaaactcgacgtcaatggc
cctgaccggcattcgctttatcgcctgctggctggcgaaggcgccgagtttcccggggat
atcacctggaatttcgaaaagtttctggtcggcaagaacggtggcgtgagcgcgcgtttc
tctccgcgtaccgcaccggatgatcccgcagtgattcaggccattgaaaaggccttggca
caaagctga

DBGET integrated database retrieval system