KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1071Help
Entry
PSPPH_1071        CDS       T00266                                 

Gene name
folE1
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00790  Folate biosynthesis
psp01100  Metabolic pathways
Module
psp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPPH_1071 (folE1)
Enzymes [BR:psp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSPPH_1071 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int QueF PHY
Motif
Other DBs
NCBI-ProteinID: AAZ34804
UniProt: Q48MN1
Position
complement(1261749..1262312)
Genome map
AA seq 187 aa AA seqDB search
MSSSLPQHYRDILLGLGEDPDREGLLDTPKRASKAMQYLCHGYTQSVDEIVNGALFASDN
DEMVIVQNIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLT
KQIADAIQQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMNTSVMLGAFRDSSTTRMEFLQ
LIGRSRQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgtccctgccccagcactatcgagacattctgctcggccttggtgaagatcca
gaccgcgaaggccttctggacaccccgaaacgcgcttccaaagcgatgcagtatctgtgt
cacggctacacccagagcgttgacgaaatcgtcaatggcgccctgttcgcatccgacaat
gatgagatggtcattgtccagaatatcgagctgtattcactctgcgagcaccacctgttg
ccattcataggcaaggcgcatgtggcttatatccctaccggcaaagtgctgggcctgtcg
aagatcgcgcgcattgtggacatgtttgcccgccgcctgcagattcaggaaaatctgacc
aagcagattgccgatgccattcagcaagtcacgggggcggcaggtgtagccgtggtcatc
gaggcaaagcacatgtgcatgatgatgcgcggtgtcgaaaaacagaattcgaccatgaac
acttcagtgatgctgggggcattccgtgactcgagcaccacccgcatggagtttctgcaa
ttgatcggacggagcagacaataa

DBGET integrated database retrieval system