KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1178Help
Entry
PSPPH_1178        CDS       T00266                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_1178 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_1178 (glk)
   00052 Galactose metabolism
    PSPPH_1178 (glk)
   00500 Starch and sucrose metabolism
    PSPPH_1178 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPPH_1178 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPPH_1178 (glk)
   00524 Butirosin and neomycin biosynthesis
    PSPPH_1178 (glk)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSPPH_1178 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383961..1384926
Genome map
AA seq 321 aa AA seqDB search
MKLALVGDIGGTNARFAIWEDDTLHSVRVFPTIDYAGPEKAIEVYLQDLELQRGDISHVC
LAVAGPVDGDFFQFTNSHWRLSREAFCADLKVDHLLLINDFTAMALGITRLKEDEYLTVC
PGAGKPDRPRVVVGPGTGLGIGTLIKLDGSRWLALPGEGGHADLPIGTAREALLWTRLMA
EHEHVSAEVVLSGAGLLLLYQVSCALDDIEPVLKSPAAVTSAALAGDPVAAAVLEQFCVF
LGRVVGNNVLTLGSLGGVYIVGGVVPRFTEFFINSGFKRAMAEKGVMSDYFKNLPVWLVT
AEYPGLMGSGVALQQAFGSQI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttggccctggtcggtgatataggcggtaccaatgcacgttttgccatttgggaa
gacgacacgctgcattctgtccgggtattcccgaccattgactacgccggcccggaaaag
gccatcgaagtctatctgcaggaccttgaattgcagcgcggtgatatcagccacgtatgc
ctggccgttgccggaccggtggatggcgattttttccagttcaccaatagtcactggcgg
ttgagccgtgaggcattttgcgctgacctgaaagtcgatcacctgctgctgatcaacgac
ttcaccgccatggcgctgggcatcacccggctcaaggaagatgaatacctgacggtttgc
cctggcgctggcaagcctgatcggccgcgtgtggtggtcgggccgggtaccgggctgggc
atcggtacgctgatcaagcttgacggcagtcgctggctggcgctgccgggcgagggcggg
catgctgacctgccaatcggcacggcacgcgaggccctgttatggacacgcctgatggct
gagcatgagcatgtcagcgctgaagtggtactcagtggcgcgggcttgctgttgctctat
caggtcagttgcgccctggacgatatcgagccagtgctcaagtcgcctgcggctgtcacc
tcggcagcgctggcgggcgacccggtagccgcagccgtgctggagcagttctgtgtgttt
ctaggcagggtggtgggcaacaatgtgctgaccctgggcagcctgggcggcgtgtacatt
gtcggcggcgtggtgccgcgcttcactgaatttttcatcaacagcggtttcaagcgcgcc
atggccgagaagggcgtgatgagcgactatttcaagaacctgccggtctggctggtgacc
gccgagtaccctggcctgatgggctcaggcgtcgctctgcaacaggccttcggttcgcag
atctga

DBGET integrated database retrieval system