KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1359Help
Entry
PSPPH_1359        CDS       T00266                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Brite
Enzymes [BR:psp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSPPH_1359 (dsbC)
Secretion system [BR:psp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSPPH_1359 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1574787..1575527
Genome map
AA seq 246 aa AA seqDB search
MRLPQIFAAAALLLAGTFSMSALADAAPDQAIRKTLDSLELQLPVESISPSPLNGLYEVK
LKGGRVLYASADGQFVVQGYLFQVQNGKPVNLTEKTERLAIAKTINAIPLSEMVIYPAVG
ETKSHITVFTDTTCPYCHKLHEEVGQLNKMGVEVRYMAFPRQGLGSPGDEQLQAVWCSKD
RKSAMDRMVDGKDIKAAKCDNPVSKQYELGQSIGVNGTPAIVLADGQVIPGYQPAAQVAK
LAMGAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgccccagattttcgctgccgccgctttactgctggccggcacattcagtatg
tctgccctggctgatgcagcccccgatcaggccatccgcaagacccttgattcgctggaa
ttgcagttgccggtcgagagtatttcgccgagcccgctcaatggcctttatgaagtgaag
ctcaagggcggtcgcgtgctttacgccagcgccgacggccagttcgtggttcagggctac
ctgtttcaggtgcagaacggcaagccggtcaacctgaccgagaagaccgagcgactggcc
attgccaagaccatcaatgccattccgctttccgaaatggtgatctacccggcggtgggc
gagaccaaatcgcacatcacggtattcaccgacactacctgcccgtattgccacaaactg
cacgaagaggtcgggcagttgaacaaaatgggcgttgaagtccgttacatggcattcccg
cgccaaggcctgggttctccgggtgacgagcagttgcaggccgtgtggtgttccaaggac
cgcaaaagcgccatggaccgcatggtagacggcaaggacatcaaggccgccaagtgcgac
aatccggtgagcaagcaatatgagctgggccagtcgatcggcgtcaacggcacccctgcg
attgtcctcgccgacggtcaggtgattccgggctatcagcctgctgctcaggttgccaaa
ctggcaatgggcgccaaataa

DBGET integrated database retrieval system